KEGG   Streptomyces coelicolor: SCO3071Help
Entry
SCO3071           CDS       T00085                                 

Gene name
SCE25.12c
Definition
(RefSeq) N-formimino-L-glutamate deiminase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3363269..3364618)
Genome map
AA seq 449 aa AA seqDB search
MTSSEQPRTYWLEHAWLGTHVEPGVALDVRDGRITAVNQGVATPPPGAGILRGLTLPGLA
NAHSHAFHRALRGTVQVGSGTFWTWREVMYSVADRLTPDTYHALARAVYAEMALAGITAV
GEFHYVHHAPGGTPYADPNAMGEALIEAAAEAGVRITLLDTCYLSSGFGEPPNTHQRRFS
DGTADAWAERCSVLKERDHARIGAAIHSVRAVPADQLATVAQWAEERRAPLHVHLSEQTA
ENDACRQAHGRTPTRLLADHGVLGARTTGVHNTHLTDEDIALLGGSRTGTCMCLTTERDL
ADGIGPAAALQRAGSPLSLGSDSHAVVDLLEEARAMELNERLRTRARGHWTAAALLRAAT
ADGHAALGWDDTGRIEAGARADLATIALDSVRTAGPLPRLGAETAVFAATAADVRHTVVG
GRHVVRDGAHTLVPDVPQALARAVEALRA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcctccgagcagccccgcacgtactggctggagcacgcctggctcggcacccat
gtcgagccgggggtcgctctggacgtccgggacggtcgcatcaccgccgtcaaccagggc
gtcgccaccccgccgcccggcgccgggatcctgcgcggactgaccctgccggggctggcg
aatgcacactcgcacgccttccaccgcgccctgcgcggcaccgtccaggtcggctccggc
accttctggacctggcgcgaggtgatgtactcggtcgccgaccggctgaccccggacacc
taccacgccctcgcccgcgccgtgtacgccgagatggcgctggccggcatcaccgccgtc
ggcgagttccactacgtgcaccacgcgcccggcggcaccccctacgccgatcccaacgcg
atgggcgaggcgctgatcgaggccgccgccgaagccggtgtccgcatcaccctcctcgac
acctgctacctgtcctccggcttcggcgagcccccgaacacccaccagcgccgcttctcc
gacggcacggcggatgcctgggccgaacgctgttcagttctcaaggaacgggatcacgcg
cggatcggggccgcgatccactccgtacgggccgtgcccgccgaccagttggcgaccgtg
gcgcagtgggccgaggagcggcgggccccgctgcatgtgcacctgtccgagcagaccgcc
gagaacgacgcctgccgccaggcccacggccgcaccccgacccgcctcctcgccgaccac
ggtgtgctgggcgcccgcaccaccggcgtccacaacacccacctcaccgacgaggacatc
gccctgctcggcggcagccgcaccggcacctgcatgtgcctcaccacggaacgggacctg
gccgacggcatcggccccgcggccgcactccagcgggcgggctcgcccctctccctcggc
tccgacagccacgccgtcgtcgacctgctggaagaagcgcgtgccatggagctgaacgag
cgcctgcgcacccgcgcccgcggccactggaccgccgccgccctgctgcgggccgccacc
gccgacgggcacgccgccctcggctgggacgacaccggccgcatcgaggccggggcccgc
gccgacctcgcgaccatcgcgctggactcggtcaggacagcgggaccgctgcccaggctc
ggcgccgagacggccgtattcgccgcgacggcagcggacgtacggcacacggtcgtggga
gggcggcacgtcgtacgcgacggggcgcacaccctcgtaccggacgtgccgcaggccctc
gcgcgggccgtcgaagccctgcgcgcctga

DBGET integrated database retrieval system