KEGG   Streptomyces coelicolor: SCO3079Help
Entry
SCO3079           CDS       T00085                                 

Gene name
SCE25.20
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO3079 (SCE25.20)
   01212 Fatty acid metabolism
    SCO3079 (SCE25.20)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO3079 (SCE25.20)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO3079 (SCE25.20)
   00640 Propanoate metabolism
    SCO3079 (SCE25.20)
   00650 Butanoate metabolism
    SCO3079 (SCE25.20)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO3079 (SCE25.20)
   00072 Synthesis and degradation of ketone bodies
    SCO3079 (SCE25.20)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO3079 (SCE25.20)
   00310 Lysine degradation
    SCO3079 (SCE25.20)
   00380 Tryptophan metabolism
    SCO3079 (SCE25.20)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO3079 (SCE25.20)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO3079 (SCE25.20)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO3079 (SCE25.20)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCO3079 (SCE25.20)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO3079 (SCE25.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3373160..3374380
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVSAARSPIGRAFKGSLKDLRADDLAATIIQAALAKVPELDPRDIDDLMLGCGLP
GGEQGNNLGRIVAVEMGMDHLPGCTVTRYCSSSLQTSRMALHAIKAGEGDVFISAGVEMV
SRFAKGNSDSLPDTRNPLFAEAEARTAEVAQQEGTTWHDPREDGLVPDPYIAMGQTAENL
ARAKGITRQDMDEFGVRSQNLAEEAIKNGFWEREITPVTLPDGTVVSKDDGPRAGVTLEG
VQGLKPVFRPDGLVTAGNCCPLNDGAAALVIMSDTKARELGLTPLARIVSTGVSGLSPEI
MGLGPVEASKQALSRAGLGVGDIDLVEINEAFAAQVIPSYRDLGIPLEKLNVNGGAIAVG
HPFGMTGARITGTLINSLRTHDKQFGLETMCVGGGQGMAMVIERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgtgatcgtctctgccgcccgttcccccatcggccgcgccttcaagggc
tccctgaaggacctgcgcgccgacgacctggccgccacgatcatccaggcggccctcgcg
aaggtgcccgagctggacccgcgggacatcgacgacctgatgctcggctgcggcctgccc
ggcggcgagcagggcaacaacctcggccggatcgtcgccgtcgagatgggcatggaccac
ctgccgggctgcaccgtcacccggtactgctcctcgtccctgcagacctcccgcatggcc
ctgcacgccatcaaggccggtgagggcgacgtcttcatctcggccggcgtcgagatggtc
tcccggttcgccaagggcaactccgacagcctcccggacacccgcaacccgctcttcgcc
gaggccgaggcccgcaccgcggaggtcgcccagcaggagggcaccacctggcacgacccg
cgcgaggacggcctcgtccccgacccgtacatcgcgatgggccagaccgccgagaacctc
gcccgcgccaagggcatcacccggcaggacatggacgagttcggcgtccggtcccagaac
ctcgccgaggaagccatcaagaacggcttctgggagcgcgagatcaccccggtgaccctg
cccgacggcacggtcgtcagcaaggacgacggcccccgggccggcgtcaccctggagggc
gtccagggcctcaagccggtcttccgccccgacggcctggtcaccgccggcaactgctgc
ccgctcaacgacggcgccgccgccctcgtgatcatgagcgacaccaaggcccgcgagctg
ggcctgaccccgctggcccgcatcgtctccaccggcgtctccggcctctcccccgagatc
atgggcctgggcccggtcgaggccagcaagcaggccctgtcccgggccgggctgggcgtc
ggcgacatcgacctggtcgagatcaacgaggcgttcgccgcgcaggtcatcccctcctac
cgcgacctcggcatcccgctggagaagctgaacgtcaacggcggcgccatcgccgtcggc
caccccttcggcatgaccggcgcccgcatcacgggcacgctgatcaactccctgcggacg
cacgacaagcagttcggcctggagaccatgtgcgtcggcggcggccagggcatggccatg
gtgatcgagcgcctgagctga

DBGET integrated database retrieval system