KEGG   Streptomyces coelicolor: SCO3123Help
Entry
SCO3123           CDS       T00085                                 

Gene name
prsA2, SCE66.02
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO3123 (prsA2)
   01230 Biosynthesis of amino acids
    SCO3123 (prsA2)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO3123 (prsA2)
  Nucleotide metabolism
   00230 Purine metabolism
    SCO3123 (prsA2)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     SCO3123 (prsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3423989..3424963
Genome map
AA seq 324 aa AA seqDB search
MTGIKTTGEKKMMFFSGRAHPELAEEVAQQLGVGVVPTKAFDFANGEIYVRYQESARGAD
CFLIQSHTAPINKWVMEQLIMIDALKRASARSITVIVPFYGYARQDKKHRGREPISARLI
ADLMKTAGADRILAVDLHTDQIQGFFDGPVDHLFALPLLADYVGAKVDRSKLTVVSPDAG
RVRVADRWCDRLGAPLAIVHKRRDKDVANQVTVHEVVGDVKGRICVLVDDMIDTGGTICA
AADALFAHGAEDVIVTATHGVLSGPAADRLKNSKVSEFVFTNTLPSASELELDKITVLSI
APTIARAVREVFEDGSVTSLFDEQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggatcaagacgaccggcgagaagaagatgatgttcttctccggccgcgcacac
cccgagcttgccgaggaggtcgcccagcagctgggggtcggggtcgtcccgacgaaggcc
ttcgacttcgccaacggtgagatctatgtgcggtatcaggagtcggcgcgtggtgcggac
tgtttcctgatccagagccacacggctccgatcaacaagtgggtcatggagcagttgatc
atgatcgacgcgctgaagcgcgcgtcggcccgctccatcaccgtcatcgtgccgttctac
ggttacgcgcggcaggacaagaagcaccgtgggcgtgaaccgatctcggcgcgtctgatc
gcggatctgatgaagaccgcgggtgcggaccggatcctggcggtggatctgcacacggat
cagatccagggcttcttcgacggtccggtggaccacctgttcgcgttgccgctgctggcg
gactacgtgggtgcgaaggtggaccgttcgaagctgacggtggtgtcgccggacgcgggc
cgggtgcgggtggcggaccggtggtgcgaccgtctgggcgcgccgctggcgatcgtgcac
aagcggcgcgacaaggacgtggcgaaccaggtcacggtgcacgaggtcgtgggtgacgtg
aaggggcgcatctgcgtcctggtggacgacatgatcgacacgggtggcacgatctgcgcg
gcggcggacgcgctgttcgcgcacggtgcggaggacgtcatcgtgacggcgacgcacggt
gtgctgtcgggtccggcggcggaccgtctgaagaactcgaaggtgagcgagttcgtgttc
acgaacacgctgccgtcggcgagtgagctggagctggacaagatcacggtgctgtcgatc
gcgccgacgatcgcgcgtgcggtgcgtgaggtgttcgaggacggttcggtgacgagcctg
ttcgacgagcagtga

DBGET integrated database retrieval system