KEGG   Streptomyces coelicolor: SCO3127Help
Entry
SCO3127           CDS       T00085                                 

Gene name
ppc, SCE66.06c
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sco  Streptomyces coelicolor
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sco00001]
   00620 Pyruvate metabolism
    SCO3127 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SCO3127 (ppc)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SCO3127 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3427132..3429867)
Genome map
AA seq 911 aa AA seqDB search
MSSADDQTTTTTSSELRADIRRLGDLLGETLVRQEGPELLELVEKVRRLTREDGEAAAEL
LRGTELETAAKLVRAFSTYFHLANVTEQVHRGRELGAKRAAEGGLLARTADRLKDADPEH
LRETVRNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDTPVNESDRRRLDTRLAENIDLV
WQTDELRVVRPEPADEARNAIYYLDELHLGAVGDVLEDLTAELERAGVKLPDDTRPLTFG
TWIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGFLSNSIRYAGATEELLAS
LQADLERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGTPHEDGRDYLGTAQL
IDDLRIVQTSLREHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDR
LGEESWRYADMPREYRTKLLAKELRSRRPLAPSPAPVDAPGEKTLGVFQTVRRALEVFGP
EVIESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADTILED
LLADPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRL
FHGRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAA
TLQASALHTAPRQSDEALARWDAAMDVVSDAAHTAYRHLVEDPDLPTYFLASTPVDQLAD
LHLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDTVLDE
MHQQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIKAEHELTVAEVLRV
TGESELLDADPVLKQTFTIRDAYLDPISYLQVALLGRQREAAAANEDPDPLLARALLLTV
NGVAAGLRNTG
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgacgaccagcagtgaactgcgcgccgacatc
cgccggctgggtgatctcctcggggagaccctggtccggcaggagggccccgaactgctg
gaactcgtcgagaaggtacgccgactcacccgagaggacggcgaggccgccgccgaactg
ctgcgcggcaccgaactggagaccgccgccaagctcgtccgcgccttctccacctacttc
cacctggccaacgtcaccgagcaggtccaccgcggccgcgagctgggcgccaagcgcgcc
gccgagggcggactgctcgcccgtacggccgaccggctgaaggacgccgaccccgagcac
ctgcgcgagacggtccgcaacctcaacgtgcgccccgtgttcaccgcgcaccccaccgag
gccgcccgccgctccgtcctcaacaagctgcgccgcatcgccgccctcctggacaccccg
gtcaacgagtcggaccggcgccgcctggacacccgcctcgccgagaacatcgacctcgtc
tggcagaccgacgagctgcgcgtcgtgcgccccgagcccgccgacgaggcccgcaacgcc
atctactacctcgacgagctgcacctgggcgccgtcggcgacgtcctcgaagacctcacc
gccgagctggagcgggccggcgtcaagctccccgacgacacccgccccctcaccttcggc
acctggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtgacctgggac
gtcctcatcctccagcacgagcacggcatcaacgacgccctggagatgatcgacgagctg
cgcggcttcctctccaactccatccggtacgccggtgcgaccgaggaactgctcgcctcg
ctccaggccgacctggaacgcctccccgagatcagcccccgctacaagcgcctcaacgcc
gaggagccctaccggctcaaggccacctgcatccgccagaagctggagaacaccaagcag
cgcctcgccaagggcaccccccacgaggacggccgcgactacctcggcaccgcccagctc
atcgacgacctgcgcatcgtccagacctcgctgcgcgaacaccgcggcggcctgttcgcc
gacgggcgcctcgcccgcaccatccgcaccctggccgccttcggcctccagctcgccacc
atggacgtccgcgagcacgccgacgcccaccaccacgccctcggccagctcttcgaccgg
ctcggcgaggagtcctggcgctacgccgacatgccgcgcgagtaccgcaccaagctcctc
gccaaggaactgcgctcccgcaggccgctggcccccagccccgcccccgtcgacgcgccc
ggcgagaagaccctcggcgtcttccagaccgtccgccgcgccctggaggtcttcggcccc
gaggtcatcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgcg
gcggtactggcccgcgaggccgggctgatcgacctgcacgccggctgggcgaagatcggc
atcgtgccgctgctggagaccaccgacgagctgaaggccgccgacaccatcctggaggac
ctgctcgccgacccctcctaccggcgcctggtcgcgctgcgcggcgacgtccaggaggtc
atgctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatc
caccgcgcccagcgccggctgcgcgacgtcgcccaccgctacggcgtacggctgcgcctc
ttccacggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgccatcctc
gcccagccctggggcaccctggagggcgagatcaaggtcaccgagcagggcgaggtcatc
tccgacaagtacctcatccccgccctcgcccgggagaacctggagctgaccgtcgcggcc
accctccaggcctccgccctgcacaccgcgccccgccagtccgacgaggccctggcccgc
tgggacgccgcgatggacgtcgtctccgacgccgcccacaccgcctaccggcacctggtc
gaggaccccgacctgccgacctacttcctggcctccaccccggtcgaccagctcgccgac
ctgcacctgggctcgcggccctcccgccgccccggctcgggcgtctcgctcgacggactg
cgcgccatcccgtgggtgttcggctggacccagtcccggcagatcgtccccggctggtac
ggcgtcggctccggcctcaaggccctgcgcgaggcgggcctggacaccgtgctcgacgag
atgcaccagcagtggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgcc
aagaccgacctgcgcatcgcccagcactacgtcgacaccctcgtcccggacgagctcaag
cacgtcttcgacaccatcaaggccgagcacgagctcaccgtcgccgaggtcctgcgcgtc
accggcgagagtgaactgctggacgccgacccggtcctcaagcagaccttcaccatccgc
gacgcctacctcgaccccatctcctacctccaggtcgccctcctcggccgtcagcgcgag
gccgccgccgcgaacgaggacccggaccccctcctcgcccgagccctcctcctcaccgtc
aacggcgtggcagcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system