KEGG   Streptomyces coelicolor: SCO3138Help
Entry
SCO3138           CDS       T00085                                 

Gene name
galT, SCE66.17c
Definition
(RefSeq) galactose-1-phosphate uridylyltransferase
  KO
K00965  
UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO3138 (galT)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3138 (galT)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     SCO3138 (galT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3438624..3439685)
Genome map
AA seq 353 aa AA seqDB search
MKKTSTRLADGRELVYYDLRDDTVRDAVDRRPLERTVTTSEVRRDPLLGDSVAVASHRQG
RTYHPPADQCPLCPSDGERLSEIPDSAYDVVVFENRFPSLAGDSGRCEVVCFTSDHDASF
ADLSEEQARLVLDAWTDRTSELSHLPSVEQVFCFENRGAEIGVTLGHPHGQIYAYPFTTP
RTALMLRSLAAHKDATGGGNLFDSVLEEELAGERVVLEGEHWAAFVPYAAHWPYEVHLYP
KRRVPDLLGLDEAARTEFPKVYLELLRRFDRIFGEGEPPTPYIAAWHQAPFGQLEEFEGV
TRDDFALHLELFTIRRTSGKLKFLAGSESGMNVFINDVPPERAAERLREVASS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagacctcgacccggctggccgacggccgtgagctggtctactacgacctgcgc
gacgacaccgtgcgcgacgccgtggaccgccgtccgctggagcggaccgtcaccacgtcc
gaggtgcgacgcgacccgctgctcggcgactccgtcgccgtcgcctcgcaccggcagggg
cgcacctaccatccgccggccgaccagtgcccgctgtgcccgtcggacggggaacggctg
agcgagatcccggactcggcctatgacgtggtggtcttcgagaatcgctttccctcgctg
gccggtgactccgggcgctgcgaggtcgtctgcttcacctccgaccacgacgcctccttc
gccgacctgagcgaggagcaggcccggctggtgctcgacgcctggacggaccgcacctcc
gagctgtcccatctgccctccgttgaacaggtgttctgcttcgagaaccggggcgccgag
atcggggtgacgctgggtcacccgcacgggcagatctacgcctacccgttcaccaccccc
cgcaccgccctgatgctccgttcactcgccgcccacaaggacgcgacgggcggggggaac
ctgttcgactccgtgctggaggaggagctggccggtgagcgggtcgtcctggagggtgag
cactgggccgccttcgtgccgtacgcggcgcactggccgtacgaggtgcacctctacccg
aagcggcgggtgcccgatctgctcggactcgacgaggcggctcgcacagaattccccaag
gtctacctggagctgctgaggcgcttcgaccggatcttcggcgagggcgagcccccgacc
ccctacatcgcggcctggcaccaggcgccgttcgggcagctggaggagttcgagggtgtg
acgcgcgacgacttcgcgctccacctggaacttttcactatccgccgtacgtccggcaag
ctgaagttcctcgcgggctccgaatccggcatgaacgtgttcatcaacgacgtacccccg
gagcgcgcggccgagcgactgcgagaggtagcgagttcatga

DBGET integrated database retrieval system