KEGG   Streptomyces coelicolor: SCO3139Help
Entry
SCO3139           CDS       T00085                                 

Gene name
SCE66.18
Definition
(RefSeq) sodium:solute symporter
  KO
K03307  
solute:Na+ symporter, SSS family
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3439885..3441573
Genome map
AA seq 562 aa AA seqDB search
MQTPTSSTYLAAELRLPTNWLDYTILGIYFVVVLGIGFAARRSVRTSLDFFLSGRSLPAW
VTGLAFVAANLGATEILGMAANSAQYGVYTTHWYWIGAIPAMVFLGLVMMPFYYGSKVRS
VPEFLLLRFDKASHLLSSALFAIAAILIAGVNLYALAIVVEALLGWPEWVAIVVAGFFVL
AYITLGGLSSAIYNEVLQFFVILAGLIPITILGLKKVGGWDGLSDSLSKSHGSDFMTAWG
GTGIGSENPLGANWLTIVLGLGFVLSFGYWTTNFAEVQRALSAKNLSAAQRTPLIAAFPK
IFIVFVVMIPGLVAAVLVPKIGTPGSDLQYNDAIPYLMQQLLPNGVLGIAVTGLLAAFMA
GMAANISSFNTVFTTDIWQKYVVKDREDGYYVRFGRLITVIGVLASIGTAFLASSFSNIM
SYLQTLFSFFNVPMFVVFIIGMFWKRASMKSGFWGLIAGTTAAMVNYFVIYKQGIIDIPS
DQGANFVSAIAGFVAGAVVMVAVSLFTAPKPTADLQGLVYGTTSPGMAEAPAKGDDAWYR
KPALLGWGAVVLAAACYIPFSF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacccccacaagctccacgtatctagccgcagagcttcgactccccaccaactgg
ctcgactacacgatcctcgggatctacttcgtcgtcgtcctgggcatcggcttcgccgcc
cgccgctcggtcaggaccagcctggacttcttcctgtccggccgttccctgcccgcctgg
gtcaccggactcgccttcgtcgccgccaacctgggtgccaccgagatcctcggcatggcc
gccaacagcgcccagtacggcgtctacacgacccactggtactggatcggcgccatcccg
gcgatggtcttcctcggcctggtgatgatgccgttctactacggctcgaaggtccgctcg
gtcccggagttcctcctcctgcgcttcgacaaggcctcccacctcctcagttcggccctg
ttcgccatcgccgccatcctgatcgccggcgtgaacctctacgccctcgcgatcgtcgtc
gaggcactgctcggctggccggagtgggtggccatcgtcgtggccggcttcttcgtcctg
gcgtacatcaccctgggcggcctgtcctcggccatctacaacgaggtcctccagttcttc
gtgatcctggcgggcctcatcccgatcaccatcctgggtctgaagaaggtcggcggctgg
gacggcctgtccgactccctctccaagtcccacggctccgacttcatgacggcgtggggc
ggcacgggcatcggcagcgagaacccgctgggcgccaactggctgaccatcgtcctgggc
ctcggcttcgtcctctccttcggctactggacgacgaacttcgccgaggtccagcgcgcc
ctgtcggcgaagaacctctcggcggcccagcgcacgcccctgatcgcggccttcccgaag
atcttcatcgtcttcgtcgtcatgatcccgggcctggtcgccgcggtcctggtcccgaag
atcggcacccccggctcggacctccagtacaacgacgcgatcccgtacctgatgcagcaa
ctgctgcccaacggcgtcctcggcatcgcggtgacgggcctgctggcggccttcatggcc
ggcatggcggccaacatctcctccttcaacaccgtcttcaccaccgacatctggcagaag
tacgtggtgaaggaccgcgaggacggctactacgtccgcttcggccgcctcatcacggtg
atcggcgtcctcgcctccatcggcacggcgttcctggcctcctccttctccaacatcatg
agctacctccagacgctcttctccttcttcaacgtgccgatgttcgtggtcttcatcatc
ggcatgttctggaagcgggcgtcgatgaagtccggcttctggggcctgatcgcgggcacg
accgcggcgatggtgaactacttcgtcatctacaagcagggcatcatcgacatcccctcc
gaccagggcgccaacttcgtctccgcgatcgcgggcttcgtcgccggcgcggtggtcatg
gtcgcggtgtccctgttcaccgcgccgaagccgaccgccgacctccagggcctggtatac
ggaaccacctccccgggcatggcggaggcgcccgccaagggcgacgacgcgtggtaccgc
aagccggcgctgctgggctggggggcggtcgtcctggccgccgcctgctacatcccgttc
tcgttctga

DBGET integrated database retrieval system