KEGG   Streptomyces coelicolor: SCO3196Help
Entry
SCO3196           CDS       T00085                                 

Gene name
SCE22.13c
Definition
(RefSeq) fructose-specific permease
  KO
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.202]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  
PTS system, fructose-specific IIC component
Organism
sco  Streptomyces coelicolor
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO3196 (SCE22.13c)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SCO3196 (SCE22.13c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     SCO3196 (SCE22.13c)
Transporters [BR:sco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    SCO3196 (SCE22.13c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3502247..3504346)
Genome map
AA seq 699 aa AA seqDB search
MSDMITADLVDLDLSADTKQAATRALAERMVALGRVTDLEGFLADVAAREAQMPTGLDGG
IGIPHCRSGHVTEPTLAFGRSTAGVDFGAADGPADLIFLIAAPAGADDAHLTILSSLARR
LMNAGFTAALRSLGEPAAAAALIRGEEPTPAADTGEDSTEDVVEDTTEETADTGAVSAAA
SAEAAPGSTGEDSGGPGRPFRIVAVTSCPTGIAHTYMAAESLEHAGREAGVEVVVETQGS
AGFTRLDPAVIAAADGVILAHDVAVREKGRFAGKPTVDTGVKAAINRPGELIGEVRDKAA
RGEVTSASPGATPVERGGESGEGYGTKLRKWLMSGVSYMVPFVAAGGLLIALGFAIGGYE
INKAPSVMDHFVWTQADSWAALLFQIGGVAFAFLVPVLAGYIAYGMADRPGLVPGFVGGS
IALTINAGFLGGLAAGLISGAVVLAIQRVPIPKALRGIMPVVVIPLVSAAVVGFLMFVVI
GKPIASAQSGMTDWLNGLSGANAVLLGALLGLMMCFDLGGPVNKVAYTFATAGIAVASPS
DSAMKIMAAVMAAGMVPPLAMALATTVRGRLFNAAERENGKAAWVLGASFISEGAIPFAA
ADPLRVIPSSMVGGAVTGALSMAFGATLRAPHGGIFVVPLIGNPLLYLVAVAAGVCVTTA
LVIVLKGLRKTVPPAAAQGPGGGADPSSRAPGAKQAVAA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatgatcaccgcggacctggtcgacctcgacctgtccgccgacaccaagcag
gcggcgacgcgcgccctggcggagcggatggtggccctgggccgggtgaccgacctggag
ggcttcctcgccgacgtggccgcccgtgaggcgcagatgccgaccggcctcgacggcggg
atcggcatcccgcactgccgcagcgggcacgtcaccgagccgacgctcgcgttcggacgc
agcacggccggcgtcgacttcggggcggcggacggaccggccgacctgatcttcctcatc
gccgctccggcgggcgccgacgacgcccacctgacgatcctctcctcgctggcccgccgg
ctgatgaacgccgggttcaccgccgcgctgcgctcgctgggcgagccggcggccgccgcc
gcgctcatccgcggggaggagccgacaccggccgcggacaccggtgaggacagcaccgag
gacgtcgtcgaggacaccaccgaggagaccgcggacaccggggcggtctcggcggcggcc
tccgccgaggccgccccgggcagcaccggtgaggattccggcgggcccgggcgccccttc
cgcatcgtcgccgtcacctcctgccccaccggcatcgcgcacacctacatggcggccgag
tcgctggagcacgcgggccgcgaggcgggcgtcgaggtcgtcgtcgagacgcagggctcg
gccggcttcacccggctcgacccggcggtgatcgcggcggcggacggcgtgatcctcgcc
cacgacgtcgccgtgcgcgagaagggccgcttcgccgggaagcccaccgtcgacaccggc
gtcaaggccgccatcaaccggccgggcgagctgatcggcgaggtccgcgacaaggcggcc
cgcggcgaggtcacctccgcatccccgggcgcgacccccgtcgagcgcggcggcgagtcc
ggcgagggctacggcaccaagctccgcaagtggctgatgtccggcgtcagttacatggtc
ccgttcgtcgccgcgggcggtctgctgatcgccctgggcttcgcgatcggcggctacgag
atcaacaaggcgccctccgtgatggaccacttcgtgtggacccaggcggacagctgggcg
gcgctgctcttccagatcggcggcgtggccttcgccttcctggtcccggtgctggccggt
tacatcgcctacggcatggccgaccggccgggcctggtccccggcttcgtcggcggctcg
atcgcgctgaccatcaacgccggcttcctcggtggtctggcggccggtctgatctccggc
gcggtggtgctggcgatccagcgggtaccgataccgaaggcgctgcgcggcatcatgccg
gtggtggtgatcccgctcgtctcggcggcggtcgtcgggttcctgatgttcgtcgtgatc
ggcaagcccatcgcctccgcgcagtcgggcatgaccgactggctgaacggcctgtccggc
gccaacgcggtcctgctcggcgcgctgctcggcctgatgatgtgcttcgacctcggcggc
ccggtcaacaaggtcgcctacaccttcgccaccgcgggcatcgccgtcgccagccccagc
gactcggcgatgaagatcatggcggcggtgatggcggccggcatggtcccgccgctggcg
atggccctggccaccaccgtgcgcggccggctcttcaacgccgccgagcgcgagaacggc
aaggccgcctgggtcctgggcgcctccttcatctccgagggcgcgatcccgttcgccgcg
gccgacccgctgcgcgtcatcccgtcctcgatggtgggcggcgcggtcaccggcgccctg
tcgatggccttcggtgcgacgctgcgcgccccgcacggcggcatcttcgtggtcccgctg
atcggcaacccgctgctctacctggtcgccgtcgcggccggggtctgtgtcaccacggcc
ctggtgatcgtcctcaaggggctgcgcaagacggtgccgccggcggcggcccagggaccc
ggcgggggcgcggacccgtcgtcccgggcgccgggcgcgaagcaggcggtggccgcgtaa

DBGET integrated database retrieval system