KEGG   Streptomyces coelicolor: SCO3197Help
Entry
SCO3197           CDS       T00085                                 

Gene name
SCE22.14c
Definition
(RefSeq) 1-phosphofructokinase
  KO
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
sco  Streptomyces coelicolor
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
   00051 Fructose and mannose metabolism
    SCO3197 (SCE22.14c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SCO3197 (SCE22.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3504474..3505421)
Genome map
AA seq 315 aa AA seqDB search
MILTVTPNPSLDRTYEVPSLDRGEVVRATGERVDPGGKGVNVSRAVTAAGRRTVAVLPLG
GAPGALVADLLDAQGIEVAPVPITGPTRSNIALAEADGVLTKINAPGPELTPDERELLLE
TVRRQSPGADWIACCGSLPRGLAPSWYADLVARAHAAGVRIALDTSGPALLRALRERPDV
VKPNAEELAEAVGRPLATVGDAVKAAEELRELGARSVLASLGADGQLLVDDAGTWFGTAR
VDAVRSNVGAGDSSLAGFLVAGGTGPGALASAVAHGAAAVQLPGSVMPTPHDLDPAAVTV
TAEVPVDRVLGEPAP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgaccgtcacccccaacccgtcgctggaccgcacctacgaggtgccctccctc
gaccgcggcgaggtcgtccgcgccaccggcgagcgggtcgaccccggcggcaagggcgtg
aacgtctcgcgcgcggtgaccgccgccggacggcgcaccgtcgcggtgctgccgctgggc
ggagcacccggcgccctggtcgccgacctgctcgacgcacagggcatcgaggtcgcgccg
gtgccgatcaccgggcccacccggtccaacatcgcgctcgccgaggccgacggcgtcctg
acgaagatcaacgcgccgggtcccgaactcaccccggacgaacgggaactgctcctggag
accgtgcgccgccagtcgcccggcgcggactggatcgcctgctgcggcagcctgccccgc
ggcctggccccctcctggtacgccgacctggtcgcccgcgcgcacgccgccggggtccgc
atcgccctggacacctccggcccggccctgctgcgggcgctgcgcgagcggcccgacgtg
gtcaagccgaacgccgaggagctcgccgaggccgtcgggcgaccgctggccaccgtcggc
gacgcggtgaaggccgccgaggagctgcgggagctgggcgcccgttcggtgctggccagc
ctgggcgccgacgggcagctgctcgtggacgacgcgggcacctggttcggcaccgcccgc
gtcgacgccgtacgcagcaacgtcggcgccggggactcctcgctcgccggtttcctcgtc
gccggcgggaccgggcccggcgccctcgcttccgccgtcgcacacggcgccgccgccgtc
cagctgcccggcagcgtgatgccgacgccgcacgacctggacccggccgccgtgacggtc
acggccgaggtgcccgtcgaccgcgtactgggggagccggcgccatga

DBGET integrated database retrieval system