KEGG   Streptomyces coelicolor: SCO3212Help
Entry
SCO3212           CDS       T00085                                 

Gene name
SCE8.05c, trpD2
Definition
(RefSeq) anthranilate phosphoribotransferase
  KO
K00766  
anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO3212 (SCE8.05c)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3212 (SCE8.05c)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     SCO3212 (SCE8.05c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3521673..3522680)
Genome map
AA seq 335 aa AA seqDB search
MQRPLTEAEAADAMRVIMRGEATAAQIAAFALAVTVRGASADNLAGMARAAQEFATPVPR
AGGDLLDTCGTGGDGLNTFNISTAAAIVAAACGVRVAKHGNRSASSACGSADVLEELGVR
IDLGAEEAAACLDRTGITFLFAPVFHPAFRHTAGPRRELGARTVFNLLGPLCNPSGARLR
TLGVPSRELVEPMTEVLERLGVTRALVFHSADGMDELSTAAPAHLVELRDGRRTTHRFDP
AEHGLARSRPGDLAGGDRAVNAAVLRRVLAGGRGPARDVVLLNAAAALRVAGVAGTWSDG
LRLAASAVDGGAAAGLLDRWAHASWQRADLVEVPA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacggcccctcaccgaggccgaggcggccgacgcgatgcgcgtgatcatgcgcggc
gaggccacggccgcccagatcgccgccttcgcactggccgtcacggtccgcggcgcctcc
gccgacaacctggccggcatggcccgcgccgcccaggagttcgccaccccggtcccgcgc
gcgggcggcgatctgctcgacacctgcgggaccggcggcgacgggctgaacaccttcaac
atctccaccgccgccgcgatcgtcgccgccgcctgcggggtacgggtcgccaagcacggc
aaccgcagcgcgtcctccgcctgcggcagcgccgacgtgctggaggaactgggcgtccgc
atcgacctcggcgccgaggaggccgccgcctgcctggaccgcaccgggatcaccttcctg
ttcgccccggtcttccacccggccttccggcacacggcgggaccgcgccgggaactgggc
gcgcggaccgtcttcaacctgctgggacccctgtgcaacccctcgggcgcccggctgcgc
accctgggggtgccgagccgcgagctggtggaaccgatgaccgaggtcctcgaacgactc
ggcgtcacccgcgccctggttttccacagcgcggacggcatggacgaactgagcaccgcc
gcccccgcccacctggtcgaactgcgcgacggacggcgcaccacccaccgcttcgacccc
gccgagcacggcctggcccggtcccgccccggcgacctggcgggcggcgaccgcgccgtc
aacgcggccgtcctgcgccgtgtcctggccggcgggcgcggacccgcgcgggacgtcgtc
ctgctcaacgccgccgcggcgctgcgggtcgccggcgtggccggcacctggtccgacggg
ctgcggctggcagcgtccgccgtcgacgggggcgccgccgccggcctgctcgaccgctgg
gcccacgcctcctggcagcgggcggacctggtggaggtgccggcatga

DBGET integrated database retrieval system