KEGG   Streptomyces coelicolor: SCO3214Help
Entry
SCO3214           CDS       T00085                                 

Gene name
SCE8.07c, trpE2
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  
anthranilate synthase component I [EC:4.1.3.27]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO3214 (SCE8.07c)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3214 (SCE8.07c)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO3214 (SCE8.07c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SCO3214 (SCE8.07c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3523296..3524831)
Genome map
AA seq 511 aa AA seqDB search
MTTHAAEAPTTDPQGAPGSQKTPDATEAEEAARATVPHRAAAAALAREHDVVPLHQEFLD
DSVSPVTAFAQLCGPDEAGFLLESVPVSGGVARYSYVGHRPVPLEPTGGDPLTALRSHLA
RSVAPVPGLPPFHGGVVGYLGYEAARHFEDLPLAAGPPPGLPESAFLAADDLVVFDHATR
RVLLMTLYRPARESYDDAVARIVRLNRALRRAPAPAAFSGRPLAAATPADHGTQGWTANL
TEAQFTERVARAREHIAAGDAFQIVLSRRLSRPLRARPTDLYRHLRATNPSPYMYHLSLG
GGRHVIGASPELLVKAEGRTVRTRPLAGTRPRHPDPAEDLRLERELRADEKERAEHVMLV
DLGRNDLGRVTEPGTVRVERLMRVERFSHVMHLSSTVRGRLAEGRDALDALRSAFPAGTL
SGAPKIRAMEIIAELEPEQRGVYGGALGFVGADGLTDFAIALRTMVVADGHVHVQAGAGI
VADSDPAAEFRETLHKSRAMLTAVRRAEAAA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacgccgccgaggcgcccacgacggacccacagggcgcaccgggctcacag
aagactccggacgcgacggaggccgaggaggccgcccgcgccaccgtcccgcaccgcgcc
gccgccgcggcactcgcccgcgagcacgacgtcgtcccgctccaccaggagttcctggac
gactcggtcagccccgtcaccgccttcgcccagctgtgcggaccggacgaggcgggcttc
ctgctggagagcgtgccggtctccggcggcgtggcacggtactcgtacgtcggtcaccga
ccggtgccgctcgagccgaccggcggcgacccgctgaccgcgctgcggtcccacctggcc
cggtccgtggcgccggtgcccggactgccgccgttccacggcggcgtcgtcggctacctc
gggtacgaggcggcccgccacttcgaggacctgcccctggccgccggaccgccgcccgga
ctgcccgagtccgccttcctcgccgccgacgacctcgtcgtcttcgaccacgcgacccgg
cgcgtcctgctgatgaccctctaccgcccggcccgcgagtcctacgacgacgccgtcgcc
cgcatcgtgcgcctcaaccgcgccctgcgccgcgcgccggcacccgccgccttctccggc
cgcccgctcgccgccgccacgccggccgaccacgggacgcagggctggaccgcgaacctc
accgaggcacagttcaccgagcgggtcgcccgcgcccgggagcacatcgcggccggtgac
gccttccagatcgtgctctcccggcggctcagcaggccgctgcgcgcccggccgaccgac
ctgtaccggcacctgcgggccaccaacccctcgccgtacatgtaccacctgagcctggga
ggaggccggcacgtgatcggcgcctcgcccgagctgctcgtcaaggcggagggccggacg
gtgcgcacccggcccctcgcgggcacccggccccgccaccccgaccccgccgaggacctg
cggctggagcgggagctgcgcgccgacgagaaggaacgcgccgaacacgtcatgctggtc
gacctcggtcgcaacgacctgggccgggtcaccgagccgggcacggtccgggtggagcgg
ctgatgcgggtcgagcgcttctcccacgtgatgcacctgtcgtccaccgtgcgcggacgg
ctcgccgagggccgggacgcgctggacgccctgcgctcggccttccccgccggaacgctc
tccggggcgcccaagatccgggccatggagatcatcgccgagctggagcccgagcagcgc
ggggtgtacggcggcgccctcggcttcgtcggcgcggacggtctgaccgacttcgccatc
gccctgcgcaccatggtcgtcgccgacggccacgtgcacgtgcaggcgggcgccgggatc
gtcgccgactccgaccccgcggccgagttccgcgagaccctgcacaagtcgcgcgccatg
ctcacggccgtacggcgggcggaggcggcggcatga

DBGET integrated database retrieval system