KEGG   Streptomyces coelicolor: SCO3215Help
Entry
SCO3215           CDS       T00085                                 

Gene name
SCE8.08c
Definition
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Ubie_methyltran Methyltransf_24
Motif
Other DBs
NCBI-GeneID: 1098649
NCBI-ProteinID: NP_627429
Kitasato: SCO3215
UniProt: Q9Z4W6
Position
complement(3524828..3525844)
Genome map
AA seq 338 aa AA seqDB search
MTGDDVQGQLAELRRSHPELHALADPRRIAAWEAARGSAPGRHDDFGADGEGSRGVEYVQ
AQALNRRARETGIRKLLGFAETARRTAAGDRPVLVDLLGGDGLVRKVCEELGIGDFNILT
CDASPHMVTTAWAAGVPALLQRAEQPLLRDHSVDAVLLAYGSHHVPSSDRQTVATEARRM
LRPGGTFVLHDFLVGSPVDVWFEEVTDVYSATGHKFLHFTRDEIEGYLEKAGYDHREVVE
IDDPYTAVAATPEEAELEIGRYLLNMYGLVKVFEGRTEQEAYRWVAETAKAVFRYPDAEG
GLASSELRQEGTGGWRVTIPRRAVVGVGRVSATAGKAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggggacgacgtgcaggggcagctggcggaactgcggcggagccaccccgagctg
cacgccctggccgacccccggcggatcgccgcctgggaggcggccaggggcagcgccccc
gggcggcacgacgacttcggcgccgacggcgagggcagccggggcgtggagtacgtacag
gcccaggccctcaaccggcgcgcccgcgagacggggatcaggaagctcctcggcttcgcc
gagaccgcccgccgcaccgcggccggcgaccggcccgtcctggtcgacctgctcggcggc
gacggactggtgcgcaaggtctgcgaggagctgggcatcggcgacttcaacatcctcacc
tgcgacgcgtccccccacatggtgaccacggcgtgggcggccggcgtgcccgccctgctc
cagcgggccgagcagccgctgctgcgcgaccacagcgtcgacgccgtactgctggcctac
ggctcgcaccacgtgccgtcctcggaccggcagacggtggccaccgaggcccgccggatg
ctccgccccggcggcacgttcgtcctgcacgacttcctcgtcggctcgcccgtggacgtg
tggttcgaggaggtcaccgacgtgtactcggcgaccggccacaagttcctgcacttcacc
cgggacgagatcgagggatacctggagaaggccggctacgaccaccgcgaggtcgtggag
atcgacgacccctacaccgcggtcgccgccacccccgaggaggcggagctggagatcggc
cggtacctgctgaacatgtacggcctggtcaaggtcttcgaggggcgcaccgagcaggag
gcgtaccgctgggtcgccgagaccgccaaggccgtcttccgctacccggacgccgagggc
ggcctcgcctcgagcgaactgcgccaggagggcaccggcgggtggcgcgtcaccattccg
cggcgtgccgtcgtcggagtgggccgggtctcggccaccgccgggaaggcggcatga

DBGET integrated database retrieval system