KEGG   Streptomyces coelicolor: SCO3227Help
Entry
SCO3227           CDS       T00085                                 

Gene name
SCE63.06, SCE8.20c
Definition
(RefSeq) aminotransferase
  KO
K16423  
(S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
sco  Streptomyces coelicolor
Pathway
Monobactam biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    SCO3227 (SCE63.06)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO3227 (SCE63.06)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     SCO3227 (SCE63.06)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3539337..3540671)
Genome map
AA seq 444 aa AA seqDB search
MTTTTPARTDRDGVLARTALHPSLSAPLLDTMNFLNEVTLRYPQAISFAPGRPYEGDFDV
ARVPGYIETYLDHLRGRGHSEERVRTALYQYGETAGQIRDIVARMLEVDEDLTVDPASVV
VTVGCQEAVLLTLRALFTGPEDVLLVDSPAYVGITGAAGLLDIPVVPVPGTPDGPSPEGL
ERTVREIEASGRRARCLYVVPDCSNPTGVSLRREARTALLDAAARLDLLLLEDNPYGVFS
RVRRPTLKSLDTERRVVYLGSFAKTAFPGARVGFVVADQLVAGADGRPPGLLAHELAKVK
SMVTVNTPTLSQAAVAGLLLQNGGGLRAANEASARHYQSTMRCLRDTLAAELPPGAPESG
GVRWNDPDGGFFLTLDVPFEADEAALDVSAEKYGVIWTPMRHFHLDDAGDRQIRLSCSYL
TTDRAAEGATRLARFVKDRAASNG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccaccccagcgcgcacggaccgggacggcgtcctggcgcggaccgccctg
caccccagcctgtccgccccgctgctcgacacgatgaacttcctcaacgaggtgaccctc
cgctacccgcaggcgatctccttcgccccgggacgcccctacgagggagacttcgacgtc
gcacgcgtccccgggtacatcgagacctacctcgaccacctgcgcgggcgcggccactcc
gaggagcgcgtccgcaccgcgctctaccagtacggcgagaccgccgggcagatcagggac
atcgtcgcccgcatgctcgaggtggacgaggacctgacggtcgaccccgcctccgtggtg
gtgacggtcggctgccaggaggccgtcctgctcaccctgcgcgccctgttcaccggtccg
gaggacgtgctcctcgtcgacagtcccgcctacgtcggcatcaccggcgcggccggcctg
ctggacatccccgtcgtgccggtgcccggcacccccgacgggccgagcccggaagggctg
gagcgcaccgtccgggagatcgaggcgagcggccggcgcgccaggtgcctgtacgtggtg
cccgactgctccaacccgaccggcgtcagcttgcgccgcgaggcccgcaccgccctgctc
gacgccgccgcgcggctggacctgctcctcctggaggacaatccctacggggtgttcagc
cgggtgcgccgccccaccctcaagtccctcgacaccgaacggcgcgtcgtctacctcggt
tccttcgcgaagacggccttcccgggcgcccgcgtcggcttcgtcgtcgccgaccagctc
gtggccggcgcggacgggcggccgcccggtctgctcgcccacgaactggccaaggtcaag
agcatggtcaccgtcaacacccccaccctgagccaggccgcggtcgccggactgctgctg
cagaacggcgggggactgcgggcggcgaacgaggcctcggcccgccactaccagtccacg
atgcggtgcctgcgcgacaccctcgccgccgaactgccgcccggcgcaccggaatcgggc
ggcgtgcggtggaacgacccggacggcgggttcttcctgaccctcgacgtgcccttcgag
gcggacgaggccgcgctggacgtctccgcggagaagtacggcgtcatctggaccccgatg
cgccacttccacctggacgacgcgggcgaccggcagatccgcctctcgtgcagctacctc
accaccgaccgcgccgccgagggggcgacgcggctggcccgcttcgtcaaggaccgcgcg
gcgtctaacggttga

DBGET integrated database retrieval system