KEGG   Streptomyces coelicolor: SCO3228Help
Entry
SCO3228           CDS       T00085                                 

Gene name
SCE63.05
Definition
(RefSeq) glycolate oxidase
  KO
K16422  
4-hydroxymandelate oxidase [EC:1.1.3.46]
Organism
sco  Streptomyces coelicolor
Pathway
Monobactam biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    SCO3228 (SCE63.05)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO3228 (SCE63.05)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.46  4-hydroxymandelate oxidase
     SCO3228 (SCE63.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3540668..3541801)
Genome map
AA seq 377 aa AA seqDB search
MREPLTLDDFARLARGQLPAATWDFIAGGAGRERTLAANEAVFGAVRLRPRALPGIEEPD
TSVEVLGSRWPAPVGIAPVAYHGLAHPDGEPATAAAAGALGLPLVVSTFAGRSLEEVARA
ASAPLWLQLYCFRDHETTLGLARRARDSGYQALVLTVDTPFTGRRLRDLRNGFAVPAHIT
PANLTGTAAAGSATPGAHSRLAFDRRLDWSFVARLGAASGLPVLAKGVLTAPDAEAAVAA
GVAGIVVSNHGGRQLDGAPATLEALPEVVSAVRGRCPVLLDGGVRTGADVLAALALGARA
VLVGRPALYALAVGGASGVRRMLTLLTEDFADTMVLTGHAATGTIGPDTLAPPHHAPPHH
GPPTAPRPAPHRDRSHG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggagccgctcacgctcgacgacttcgcacgactcgcacgcgggcaactgcctgcc
gccacctgggacttcattgcgggcggcgcggggcgggagcggaccctcgccgccaacgag
gccgtcttcggagccgtacggctgcggcccagggcactgcccggcatcgaggagccggac
acctccgtggaggtgctcggctcccggtggccggcgcccgtgggcatcgcgccggtggcc
taccacgggctcgcccaccccgacggcgaaccggcgaccgccgcggcggcgggcgcgctc
ggactcccgctcgtcgtcagcaccttcgccggccggagcctcgaagaggtggcccgcgcg
gcgagcgcaccgctgtggctccagctgtactgcttccgcgaccacgagaccaccctgggc
ctggcccgcagggcccgcgacagcggctaccaggcgctggtgctcaccgtcgacaccccg
ttcaccggccgccggctgcgcgacctgcgcaacggcttcgcggtccccgcccacatcacc
ccggccaacctgaccggcacggcggcggccggcagcgccacccccggcgcgcacagcagg
ctggccttcgaccgccgcctggactggtccttcgtggcccgcctgggcgcggcgagcggc
ctgccggtgctggccaagggcgtgctgaccgcgccggacgccgaggccgcggtcgcggcg
ggcgtcgcgggcatcgtcgtctccaaccacgggggccgccaactcgacggcgcaccggcc
accctggaggcgctgcccgaggtggtgtccgccgtgcgcggacgctgcccggtcctcctc
gacggcggcgtccgcaccggcgccgacgtcctcgccgccctggccctcggtgcccgtgcc
gtcctggtcgggcgccccgcgctgtacgcgctggcggtcggcggcgcctcgggcgtgcgc
cggatgctcaccctgctgaccgaggacttcgcggacacgatggtgctcaccggccacgcc
gccaccggcacgatcggcccggacaccctggccccgccgcaccacgccccgccgcaccac
gggccgcccaccgcgccccgcccggcgccgcaccgagacaggagccacggatga

DBGET integrated database retrieval system