KEGG   Streptomyces coelicolor: SCO3229Help
Entry
SCO3229           CDS       T00085                                 

Gene name
SCE63.04
Definition
(RefSeq) 4-hydroxyphenylpyruvic acid dioxygenase
  KO
K16421  
4-hydroxymandelate synthase [EC:1.13.11.46]
Organism
sco  Streptomyces coelicolor
Pathway
Monobactam biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    SCO3229 (SCE63.04)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO3229 (SCE63.04)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.46  4-hydroxymandelate synthase
     SCO3229 (SCE63.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3541951..3543066)
Genome map
AA seq 371 aa AA seqDB search
MLPPFPFLHWRAAMPPSDIAYAELYVADDREASGFLVDSLGFVPLAVAGPATGTHDRRST
VLRSGEVTLVVTQALAPDTPVARYVERHGDSIADLAFGCDDVRSCFDRAVLAGAEALQAP
TPSHRAGQDAWFATVSGFGDIRHTLVPAADGDGAGLLPPDRDWALLPAATGRTGPRPLLD
HVAVCLESGTLRSTAEFYEAAFDMPYYSSEYIEVGEQAMDSIVVRNAGGGITFTLIEPDD
TRVPGQIDQFLSAHDGPGVQHLAFLVDDIVGSVRSLGDRGVAFLRTPGAYYDLLTERVGA
MADAIEDLRETNVLADRDEWGYLLQIFTRSPYPRGTLFYEYIQRNGARGFGSSNIKALYE
AVEREREVAGR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgctccctcctttccccttccttcattggagagccgccatgccgcccagtgacatcgcg
tacgccgagctgtacgtcgcggacgaccgggaggcctccggcttcctcgtcgacagcctc
ggtttcgtccccctggcggtggcgggccccgccaccggcacccacgaccgccggtccacg
gtgctgcgcagcggcgaggtcacgctcgtggtcacccaggcgctggcgccggacaccccg
gtcgcccggtacgtggagcggcacggcgactccatcgccgacctcgccttcggctgcgac
gacgtgcgctcctgcttcgaccgcgcggtcctcgccggtgccgaggcgcttcaggccccg
acgccctcccaccgggcgggccaggacgcgtggttcgccaccgtctccggcttcggggac
atccggcacaccctggtcccggcggcggacggggacggcgcggggctgctgccgcccgac
cgggactgggcgctgctcccggccgccaccggccgcacggggccgcggcccctcctcgac
cacgtcgccgtctgcctggagtccggcacgctgcggagcaccgccgagttctacgaagcg
gccttcgacatgccctactactcctccgagtacatcgaggtgggcgagcaggcgatggac
tccatcgtcgtgcgcaacgccggcggcggcatcaccttcacgctcatcgaaccggacgac
acccgggtgccgggccagatcgaccagttcctgagcgcccacgacgggccgggcgtccag
cacctggccttcctggtggacgacatcgtcggctcggtccgctcgctcggcgaccgcggc
gtggccttcctgcgcaccccgggcgcctactacgacctgctcaccgagcgggtcggcgcg
atggccgacgccatcgaggacctgcgcgagaccaacgtcctcgcggaccgcgacgagtgg
ggctacctgctgcagatcttcacccgctcgccctacccgcgcggcaccctcttctacgag
tacatccagcgcaacggcgcccgcggcttcggcagttccaacatcaaggccctgtacgag
gccgtcgagcgggagcgggaagtggccggccgatga

DBGET integrated database retrieval system