KEGG   Streptomyces coelicolor: SCO3230Help
Entry
SCO3230           CDS       T00085                                 

Gene name
cdaPSI, SCE63.03c
Definition
(RefSeq) CDA peptide synthetase I
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
3543335..3565726
Genome map
AA seq 7463 aa AA seqDB search
MSENSSVRHGLTSAQHEVWLAQQLDPRGAHYRTGSCLEIDGPLDHAVLSRALRLTVAGTE
TLCSRFLTDEEGRPYRAYCPPAPEGSAAVEDPDGVPYTPVLLRHIDLSGHEDPEGEAQRW
MDRDRATPLPLDRPGLSSHALFTLGGGRHLYYLGVHHIVIDGTSMALFYERLAEVYRALR
DGRAVPAAAFGDTDRMVAGEEAYRASARYERDRAYWTGLFTDRPEPVSLTGRGGGRALAP
TVRSLGLPPERTEVLGRAAEATGAHWARVVIAGVAAFLHRTTGARDVVVSVPVTGRYGAN
ARITPGMVSNRLPLRLAVRPGESFARVVETVSEAMSGLLAHSRFRGEDLDRELGGAGVSG
PTVNVMPYIRPVDFGGPVGLMRSISSGPTTDLNIVLTGTPESGLRVDFEGNPQVYGGQDL
TVLQERFVRFLAELAADPAATVDEVALLTPDERERVLDGWNDTAHEVPETTLPELFAARA
ARTPGHEALVYEGTSLTYAELDARAERLAGALTARGAGPERFVAVAVERSAELVVALLAV
LKSGAAYVPVDPGYPADRIAHILRDAGAMLVLTTRDTAERLPGDGTPRLLLDEPAAAGTT
AAGAPAPPGTLPRALPAPGHPAYVIYTSGSTGRPKGVVISHRAIVNRLAWMQDTYGLEPS
DRVLQKTPSGFDVSVWEFFWPLVQGATLVVARPGGHTDPAYLAGTVRREGVTTLHFVPSM
LDVFLREPAAAALGGATPVRRVFCSGEALPAELRARFRAVSDVPLHNLYGPTEAAVDVTY
WPCAEDTGDGPVPIGRPVWNTRMYVLDAALRPVPAGVPGELYIAGVQLARGYLGRPALSA
ERFTADPHGAPGSRMYRTGDLARWNHDGSLDYLGRADHQVKLRGFRIELGEIEAALVRQP
EIAQAAVVLREDRPGDQRLVAYTVPARDADTLTGPPAEAGTHPGPGAAPDTDPATGPAAG
TDSGPGSGTGSGTGSGTGSGARPGPDGTATHTVAGAGPAAAGETAAGADAGTGTGETGAG
ADAGTGTGAHAGPDGAVLAARLRELLPGYMVPSAFVALPRLPVTPNGKLDRRALPAPAES
GRAAGRAPRTPGEELLCALFAEVLGVAEVRVDDGFFDLGGHSLLATRLISRIRATAGAEV
PIRRVFEAPTVAELAPALTDGGRARAAVTARPRPDRLPLSFAQRRLWFIHQYEGPSPLYN
IPAALRLTGPVDGAALSAALGDVVARHESLRTVFAEDAHGPHQVILSAERAAPRLKTLDS
DPERLAADLARTARHTFDLTRDVPLRATLLRVAPEEHVLLLVLHHIAGDGWSLAPLARDL
GTAYAARTAGTAPDWAPLPVQYADYTLWQRELLGADGNGAGTGDGGEGARQLAHWREALA
GLPERLELPSDRPRPARRDNSGARLDVSVPAGLHRSLAALAAETRTSVFMVLQAALAGLL
TRLGAGEDVPIGSTIAGRTDAAVENLVGFFVNTLVLRTDTGGDPAFRELLSRVRERDLAA
YAHQDVPFERLVEAVNPDRATSHHPLFQVMLTFDTTQQDALGELGRLPGITTSLLPVHTG
LSRFDLVFAFDERRDAAGGQAGLDLAVEFSTELFDAGTVRALTERLLLLLTQVAADPGVR
LGDLDVLLPGEHHDLLVAANRPGTAPASPAPASPEPASPEPASPAPGTATLPELFERQAA
RHPDRTALTFEGTSLSYAELNARANRLARLLTARGIGPDALVALALPRSAELVVALLAVV
KSGAAYVPLDPGYPADRLAHALSDSAPAALLTDRATAGRLPAHEVPRIVLDAPAPADGGT
TGGDPADAHPATDLAQGERVRPLDPRDTAYVIYTSGSTGRPKGVAVPHGNVVRLFSATAP
WFGFDEHDVWTLFHSYAFDFSVWELWGPLLHGGRLVVVPHDVTRDPAAFLALLARERVTV
LNQTPSAFHQLAAADRENPTELALRTVVFGGEALDLSRLADWYERHAEDAPALVNMYGIT
ETTVHVSHFALDRATAAASSASTIGVNIPDLRVYVLDDRLRPTAPGVTGEMYVAGAGLAR
GYLGRPALTADRFPADPYAALFGERGTRMYRTGDLARRRTDGGLDYLGRADQQVKIRGFR
IEPGEIEAVLAAHPAVDDVAVVAREDVQGDPRLVAYVVTGSGATARALHDHAAGHLPDHM
LPSAFVTLDVLPLTPNGKLDTKALPAPAHAGQVTGRAPRGPREEILCALFAEVLGVPRLT
VDDSFFDLGGHSLLATRLAGRIRGTLGVELSVRRLFETPTVAGLSAALDGAERSGTGPTA
GERPERLPLSYAQQRLWFLHQLEGPSPTYNITGALRLTGDLDPGALRAAFQDVVTRHESL
RTVFSEDGHGARQTVLDAAGVRFELPVADVSEDRLDARLEEAARHCFDLTTDIPVRAELF
RLGAREHVLLLMVHHIAGDGWSLGPLIRDLAAAYTARAARRAPDWAPLPVQYADFALWQR
AALGDAADATSPAGRQLAHWKEALAGLPDRLELPADRPLPAVASHRGGRVPLTVPAPLHS
GVAELARESRTSVFMVLQAALAALLTRMGAGEDVPLGTPVAGRGDDAVDQVVGFFVNTLV
LRTDTGGNPTFRALLDRVRDTDLTAYDHQDLPFEHLVDVLSPTRSLSHNPLFQVLLSLDT
TQQDALAALSATGLGVRLLNVTTGVAKLDLALEIAEHRDADGAPAGLVGAAEYSADLFDE
GTVTLLVERFLRLLDALVADPSRRIGDVDVLGPRERERVLTEWNDTPRRPVQGTFADHVA
RHAAERPGHLAVETAGAAAPGGALTYGELNERANRLARALLARGAGPERFVAVALPRSAD
LVLSALAAFKAGAAYLPVDPAHPAERITHLVSDAAPTLIVTTSALAASLPDTGTPVLLLD
TPETAATLAALPGHDVTDADRPVPLRPEHPAYMIYTSGTTGRPKGVVVTHTGLPGLLDIF
TRDCAAGPGSRILQHLSPSFDASFWELAMGLLTGATLVVAPPETTPGPELAELATRHAAT
HLSLTTSVLGLLPPDSLPDGLTLVVGAEAIPPELVERWSPGRTMLNSYGPTETTVCSTMS
GPLSGPAVPPIGSPVANSAVYVLDAALRPVPPGVPGELYAAGAHLARGYHDRRALTAERF
VANPFGEPGSRLYRTGDLVRWRPDGQLEYLGRADTQVKIRGLRIEPTEIEAVITERPHLA
RAAVIVREDRPGDRRLVAYVVPEPGATVDTAELRAALRETLPDHMIPTAFVVLDALPLTL
NGKLDRKALPAPDYSARTSGRAARDPRERLLTALFGEILGVEPAGVDDGFFDLGGDSILS
IQLVARARAAGLVLSVRDVFEHQTPALLARSAAAAPAGDRTARDSDVPADGPAPRTPMMG
WFAALGSDLAAFNQSLVLRVPAALDPDTLDTALRAVLDRHDALRMRVADDWTIEIPPPGS
VTPADCLVRFDAVGLDEAAVRSAVTEQARTARDRLAPADGRMLQAVWLDRGADRDGLLLL
VANHLVVDGVTWRILVPDLAAAYAGETLAPVGTPWRHWALSLSDLAGQPRTEEELDHWHS
VLGDTPHTLRLDPARDTHATAGEITAELDADTTEALLTWVPGVCHATVNDVFLSTFALAV
AGWRRGRGEDADAPVVLDLESHGRHEEAVPGVELSRTAGWFTSMYPVRLAPPAGASGDGS
ALRALKAVKEQLRTVPGDGLGYGLLRHLNPRTRAALAALPLPEFGFNYLGRIGQEGTDEA
PWTIEGGDVAGIDGAMPLAHPVDVNAVARETADGTRLRARWTYSRTALEPEDTQRLADTW
FRLLRRLVEEARQPGAGGLTPSDIAHPALAQDEIEDLEHTVPGLQDILPLAPLQEGFLFL
NLYDENARDVYVGQLAFDLEGSFDGTRMRAAAGALLRRHANLRAGFRQTATGTWVQVVPA
ELEPDWRECDLTDRADEAERDAEAGRLAAGDRERRFDLTSPPLMRFTAIRLSADRVRLVM
TNHHILLDGWSMPLLWQELTELYVSGGDPVSLPPVRPYRDHLAWLGARDRDAARDAWRRS
LSGLDEATLLAPDAGPAEAAPLGIPFGLDRDATAALSAWARGRGVTMNTVVQGAWALALA
QATGRDDVVFGATVSGRPPELPGVESMIGLFINTLPVRARLDQAEPLGDLFRRLQNEQAR
LLDHQWPGLADIQHWAGHGELFDTAMVFQNYPVSADTTSRQLDGLRVAGYDAVESTDFAV
NLVAHTRDDALRLRLDYRADACAGDLVRSLADRMLRVLEALVTDSDRPVAHLDTLDPAVR
ERVLVEWNGAPTQLPGTPLHELISEQARLTPDAVAVVCDGTSLTYAELDGGANQLARHLL
GEGLGAEDFVAIALAKSLDAVISMLAVLKTGAAYLPIDPDYPAERITYMLDDARPALTLT
EPVPVERYTGHSVTAVTDEERRSPWSARHAAYMIYTSGSTGRPKGVVIEHHALATYLHRA
RNTYTAMTGVTVLHSPLAFDLTITALWTPLTSGGTVHLTSLEESDTQPSLIKATPSHLPL
LTTLPETASPSHTLILGGEALHTDHLVTWRTQHPGVQIINAYGPTESTVNITDHHVGEDT
PDGPVPIGRPFANTQVYVLDSALRPVAPGVTGELYLAGEQLARGYLGRPALTAERFTANP
HSSTPGARMYRTGDLAHWNHHGHLTYDGRADHQIKLRGHRIEPGEIEATLTAQTGITQAT
VQLREDQPGDQRLVAYLVVNDSTEYDEKTVRDALTSALPDYMVPSALVTLDALPLTPNGK
LDRTALPAPAYSASTAGRAPRTPREEVLCTLFAEVLGVDLVTIDDNFFDLGGHSLLATRL
VSRTRTALGVELSIRQLFETPTVAGLAEALDASGTVRTALTARPRPERIPLSYAQQRLWF
LHQLEGPSATYNTVLTLRLGGALDVDALRAAISDVVARHESLRTVFTEDERGAYQIVLPV
EAASTPFTVVDVAEEEIGDRLDEAVGHCFDLAQELPARTSLFRVSEREHVLLLLIHHIAS
DAWSRAPLAQDLTAAYAARVRSEAPMWAPLTVQYADYALWQQEILGDDTDADSLAGRQLA
YWKQQLAGLPEQLDLPTDRPRPAVAGYSGDRVPFTVPTELHTRLTELARATNTSAFMVIQ
AAVAVLLTRLGAGEDIPIGTPVAGRTDDAADDLIGLFINTLVLRTDTSGDPTFRRLLDRV
RDTDLAAYAHQDLPFERLVEALNPARTLSHHPLFQVLLTFNNTDHEGALKDISELPGLTV
ALREVQRTSSKFDLSFGFAESFDTSRRPQGIEAALDFSTELLDRRSAQAIADRFLRVLEA
VTTAPDRPIGAVELMDPAERERVLVEWNGAPTQLPGTPLHELISEQARLTPDAVAVVCDG
TTLTYAELDRRANQLARHLLGEGLGAEDFVAIALAKSLDAVISMLAVLKTGAAYLPIDPD
YPAERITYMLDDAQPALTLTAPIPPASYDSRPTSEITDVERRSPWSARHAAYMIYTSGST
GRPKGVVIEHHALATYLHRARNTYTAMTGVTVLHSPLAFDLTITALWTPLTAGGTVHLTS
LEEAEVQPSLIKATPSHLPLLTTLPETASPSHTLILGGEALHTDHLATWRTQHPGAQIIN
AYGPTESTVNITDHHVSEDTPDGPVPIGRPFANTQVYVLDSALRPVAPGVTGELYLAGEQ
LARGYLGRPALTAERFTANPHSSTPGARMYRTGDLAHWNHDGHLTYDGRADHQIKLRGHR
IEPGEIETTLTAQTGITQTTVQLREDTPGDQRLVAYLVVNDSTEYDEPTLRDALASALPD
YMRPSAYVTLDALPLTPNGKLDRTALPAPAYSASTTGRTPRTPREEILCTLFAEVLGVDL
VTIDDNFFDLGGHSLLATRLVSRARTALGVELSVRQFFETPTIAGLSGAFDRAGRARAAL
TARPRPERIPLSYAQQRLWFLHQLEGPSATYNIPTTLRLTGTLDTDALQSALNDLLARHE
SLRTTYTEDGEGPRQVIHAWEPGMLPLGVVDTGEGELDAMLSAGVHHAFDLTAGIPVRAT
LFRISEQEHVLLLLIHHIATDAWSRTPLGHDLAAAYSARCAGDVPAWEPLPVQYADYALW
QREVLGDEGDADAPAGRQLAYWTRQLADLPEQLDLPTDRPRPAVASQDGDRVAFSLDADL
YVRLTELARATHSSTFMVVQAALAVLLTRLGAGEDIPIGTPVAGRTDDATENLVGFFVNT
LVLRNDTSGNPTFRELLEETRRTDLAAYAHQDLPFERLVEALNPARTLAHHPLFQVMLIL
STAETDPDASLALPGLRVGAERSRLGAAKVDLAFALAEVRDGEGRSTGLTGALDFRTDLF
DRSTARSLVERFVRTLEAVVADPGVRLSRVPVLTGSERRSLLDRGTGPLLEGLDATLPEL
FAEQALRTPGAPALVRGGTTVSYAELDLRTNRLARLLRQQGVRPGTPVVMLMERSPAHVV
ATLAIAKAGGAYVPLHDTYPLDRMRHVVADTAATLILTDRAEAARAGQLGARVMVVDEFG
AAPSGSEADAAPGTGTGTGTGSRSGYVDDAPEVGLRPQDLAYVMYTSGSTGVPKGVAVTH
RGVVDLVRDHCWRPGVHERVLLHAPHAFDVSCYEMWVPLVSGGTVVVAPPGHLDPAAITD
LITAHDITAIHLTAGFFRVVAEEAPECFAGVREVLTGGDVVSPAAVARVLAHHPRIVLRH
LYGPTETTLCVTQHEVTAPYEARGSLPVGRATGNTRAYVLDRYLQPVPAGVPGELFISGS
GLARGYLDRPDLTCERFVADPYGGSGERMYRTGDLVRYNAAGELEYLARADDQVKIRGFR
VELGEIEAVLATRPELAQAAVVVREDRPGDRRLVGYVVAAAGRDGEVDPDALRAFSRQAL
PDYMVPSAFVVLGTLPLTANGKLDRKALPAPDYGAASTGRAARTPAEELLCTLFAQVLGL
SAVGVDDGFFDLGGDSILSIQLVSRARAAGLALAVRDVFEHQSTARLAAALTDRDDAASV
PEAEAVPPYGPAPLTPVMARIAELGLGGDDFNQSVVVSLPPAVDRDRLVPALQRVLDHHD
ALRLRVLPDGSTEVRAPGSVPAADVLSVVTRAPGATGEARDALLVEAACAARDRLAPAEG
RMLQAVLVDGTDDTDGTGGTSGADGVLILVAHHLVVDSVTWSIVVPDLAAAYRGEEPAPV
GTSWRQWATSLARLATDPRVEAETAHWEHTLTGAGTLRLDRGRDLQGDAGRISLDLAPHT
TEALLTRLPGGVNASVHDVLLTAFAFAVAGWRRGRGEDPDAPVVLDLESHGRHEEAVPGA
ELSRTAGWFTALHPVRLAPDVTDWARLHQDGDALRDGLKQVKEQLRSVPGDGLGHGLLRH
LNPTAGPRLARLPEPDFGFNYLGRRVTPATGTPEPWTVTGGGLAASRPTAPMAHAVELSA
VVHEGADGPRLRAEWTYARRLVPDHDARRLAEQWFRALEALVEQADRAGTGGLTPSDVTL
GSLSQSEIEEFESDLESEWEIEQ
NT seq 22392 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagaactcttcggttcggcacggtctgacgagcgcgcagcacgaggtgtggctc
gcccagcagctggatccgcgtggcgcgcactaccggacgggatcctgcctggagatcgac
ggacccctggaccacgcggtgctgagccgcgccctgcggctcaccgtggccggtacggag
acgctctgctcgcgcttcctcaccgacgaggagggccggccgtaccgcgcgtactgcccg
cccgcgccggagggttcggccgccgtcgaggacccggacggggtgccgtacacccccgtg
ctgctgcgccacatcgacctctccggtcacgaggaccccgagggcgaggcccagcggtgg
atggaccgggaccgcgcgacgccgctgccgctggaccggcccggcctgagcagccacgcg
ctgttcacgctcggcgggggccggcacctgtactacctgggcgtccaccacatcgtgatc
gacggcaccagcatggccctgttctacgagcggctggccgaggtgtaccgcgcgctgcgg
gacgggcgtgcggtgcccgcggccgccttcggggacacggaccggatggtcgcgggcgag
gaggcctaccgcgcgtcggcgcggtacgagcgtgaccgggcctactggaccggcctgttc
accgaccgccccgagcccgtctcgctcaccgggcgcggcggcggccgggccctcgcgccg
accgtgaggagcctgggcctgcccccggagcgcacggaggtgctcggccgggccgccgag
gcgaccggtgcgcactgggcgcgcgtggtcatcgccggtgtggccgccttcctgcaccgg
acgacgggcgcccgggacgtcgtggtgtcggtgccggtcaccgggcgctacggcgcgaac
gcccggatcacccccggcatggtctccaaccggctgccgctgcggctggcggtgcgcccc
ggcgagagtttcgcgcgggtggtcgagaccgtgtccgaggcgatgagcggcctcctggcg
cacagccgcttccgcggcgaggacctcgaccgggagctgggcggcgcgggggtgtcgggg
cccaccgtcaacgtcatgccgtacatcaggccggtggacttcggcggtccggtcggcctg
atgcgcagcatcagttcgggtccgaccaccgatctgaacatcgtgctgaccggcaccccc
gagtccggcctgcgcgtcgacttcgagggcaacccgcaggtgtacggcggccaggacctg
acggtgctgcaggaacgcttcgtccggttcctggcggagctggcggccgaccccgcagcc
accgtcgacgaggtcgcgctgctgacgccggacgagcgggagcgggtcctcgacgggtgg
aacgacaccgcccacgaggtcccggagaccacgctgcccgagctgttcgccgcgcgggcc
gcgcgcacgcccgggcacgaggccctggtctacgagggcacctcgctgacgtacgccgaa
ctggacgcccgcgccgagcggctggccggtgcgctgacggcgcggggcgcgggcccggag
cggttcgtcgcggtcgccgtggagcggtccgcggagctggtggtggcgctgctcgcggtg
ctcaagtcgggcgcggcgtacgtacccgtggaccccggctacccggccgaccgcatcgcg
cacatcctgcgggacgcgggcgcgatgctggtgctgaccacccgggacacggcggagcgg
ctgcccggggacggcacgccgcggctgctgctcgacgagccggccgcggcggggaccacc
gcggcgggggcacccgccccgcccggcaccctcccgcgggcgctgcccgctcccggccac
cccgcctacgtcatctacacctcggggtccaccggccgccccaagggcgtggtgatctcc
caccgggcgatcgtcaaccggctggcctggatgcaggacacctacggcctggagccgtcc
gaccgggtgctgcagaagacgccgtccggtttcgacgtgtccgtgtgggagttcttctgg
ccgctcgtccagggcgccaccctggtcgtggcccggcccgggggccacactgacccggcc
tacctggccggcaccgtccggcgcgagggcgtgaccaccctgcacttcgtgccgtcgatg
ctcgacgtgttcctgcgggagcccgccgcggccgcgctgggcggtgcgacgccggtgcgg
cgggtgttctgcagcggcgaggcgctcccggcggagctgcgggcccgtttccgggccgtg
tcggacgtgcccctgcacaacctgtacgggcccaccgaggccgccgtcgacgtgacgtac
tggccgtgcgccgaggacaccggcgacgggccggtgccgatcggacggccggtgtggaac
acccggatgtacgtgctcgacgccgcgctgcggccggtcccggccggggtgcccggcgag
ctgtacatcgccggtgtgcagctcgcccgcggctacctgggccgccccgcgctgagcgcc
gaacgcttcaccgccgacccgcacggcgcgcccggcagccggatgtaccgcaccggcgac
ctggcgcgctggaaccacgacggcagcctcgactacctcgggcgcgccgaccaccaggtc
aagctgcgcggcttccgcatcgaactcggcgagatcgaggccgcgctcgtacggcagccg
gagatcgcccaggccgccgtcgtcctgcgcgaggaccgccccggcgaccagcgcctggtc
gcctacaccgtgccggctcgggacgcggacacgctcacgggcccgcctgcggaggcgggg
acgcaccccgggccgggcgccgcaccggacacagacccggccaccgggcccgccgccggg
acggactccggcccggggtccggaacggggtccggaacggggtccggaacggggtccgga
gcgcgccccggaccggacggcacggcgacgcacaccgttgccggcgccggaccggccgcg
gccggggaaaccgccgccggggcggacgccgggaccgggaccggggaaaccggcgccggg
gcggacgccgggaccgggaccggggcacacgccggcccggacggtgccgtgctcgccgcg
cggctgcgggagttgctgcccgggtacatggtgccctcggccttcgtcgcgctgccccgg
ctgcccgtcacaccgaacggcaagctggaccggcgggccctgcccgcccccgcggagtcc
gggcgcgccgccgggcgggcgccgcgcacgccgggcgaggagctgctgtgcgcgctcttc
gccgaggtgctcggcgtggccgaggtcagggtcgacgacggcttcttcgacctgggcggc
cactcgctgctcgccacccggctgatcagccgcatccgcgccaccgccggggcggaggtg
ccgatccggcgcgtcttcgaggcgccgaccgtggcggagctggccccggcgctgacggac
ggcgggcgggcccgtgccgcggtcaccgcccggccgcgccccgaccgcctgccgctctcc
ttcgcgcagcggcgcctgtggttcatccaccagtacgaggggccctcgccgctctacaac
atcccggccgcgctgcggctgacgggcccggtggacggcgccgccctgtcggcggccctc
ggcgacgtggtggcccggcacgagagcctgcgcaccgtcttcgccgaggacgcgcacggc
ccccaccaggtgatcctgtccgccgagcgggccgcgccccggctcaagacgctggacagc
gacccggagcggctggccgccgacctcgcgcgcaccgcccggcacaccttcgacctgacc
cgggacgtaccgctgcgggccaccctgctgcgggtggcgcccgaggagcacgtgctgctc
ctcgtcctgcaccacatcgcgggcgacggctggtcgctggcgcccctcgcccgggacctg
ggcaccgcctacgccgcccggaccgccggcacggcccccgactgggcgccgctgccggtg
cagtacgccgactacacgctgtggcagcgtgaactgctcggcgccgacgggaacggcgcg
ggcaccggggacggcggtgagggcgcccggcagctcgcccactggcgcgaggcgctggcc
gggctgccggagcggctggagctgccgagcgaccggccgcgaccggcgcgccgcgacaac
tccggcgcgcgcctggacgtgtccgtgcccgccgggctgcaccgctcgctggccgcgctc
gccgccgagacgcggaccagcgtcttcatggtgctccaggccgcgctggcggggctgctg
acccggctcggcgcgggcgaggacgtgcccatcggctcgaccatcgcgggccgcaccgac
gccgccgtcgagaacctggtcggcttcttcgtcaacacgctggtgctgcgcaccgacacc
ggcggcgacccggccttccgcgagctgctctcccgcgtccgcgagcgcgacctggccgcc
tacgcccaccaggacgtgcccttcgagcggctcgtcgaggcggtcaacccggaccgggcc
acctcccaccacccgctgttccaggtgatgctgaccttcgacaccacccagcaggacgcc
ctcggcgagctgggccggctgcccgggatcacgacctcgctgctgcccgtgcacaccggg
ctgtcccggttcgacctcgtgttcgccttcgacgagcggcgggacgccgcgggcgggcag
gccggtctcgacctcgcggtggagttcagcaccgagctgttcgacgccggcaccgtgcgc
gccctcaccgagcggctgctgctactgctcacgcaggtcgccgccgatcccggcgtgcgc
ctgggcgacctcgacgtcctcctccccggcgagcaccacgacctgctggtggccgccaac
cggcccggcaccgcgcccgcttcaccggcacccgcttcaccggagcccgcgtcaccggag
cccgcgtcccccgcgccggggacggccacgctccccgagctgttcgagcggcaggccgcc
cggcaccccgaccgcaccgcgctgaccttcgagggcacctcgctgtcctacgccgagctg
aacgcgcgcgccaaccgcctggcccggctgctgaccgcccgcgggatcggccccgacgcg
ctggtcgccctggccctgccccgctccgccgaactggtcgtggccctgctcgcggtggtc
aagtcgggcgccgcctacgtgccgctcgacccgggataccccgccgaccggctcgcccac
gcgctgtccgactccgcgcccgcggccctgctcaccgaccgcgccaccgccggccggctg
cccgcccacgaggtgccccgcatcgtcctcgacgcccccgccccggcggacggcggcacc
acgggcggcgacccggcggacgcccaccccgccaccgacctggcgcagggcgagcgggtc
agaccgctggacccgagggacacggcgtacgtcatctacacctccggctcgacgggccgc
cccaagggcgtggccgtgccgcacggcaacgtcgtacggctcttctccgccaccgcgccc
tggttcggcttcgacgagcacgacgtgtggacgctcttccactcgtacgccttcgacttc
tcggtgtgggagctgtggggtccgctgctgcacggcggccggctcgtcgtcgtcccgcac
gacgtcacccgggaccccgccgccttcctcgccctgctcgcgcgcgaacgcgtcaccgtc
ctcaaccagacgccgtccgccttccaccagctggccgccgccgaccgtgagaaccccacc
gaactcgccctgcgcaccgtggtgttcggcggtgaggccctggacctgtcccggctggcc
gactggtacgagcggcacgccgaggacgcgcccgccctggtcaacatgtacggcatcacc
gagaccaccgtccacgtctcgcacttcgccctggaccgggccaccgcggccgcctcgtcc
gccagcaccatcggcgtcaacatccccgacctgcgggtctacgtcctcgacgaccggctg
cgccccaccgctcccggcgtcaccggcgagatgtacgtggccggtgcgggcctcgcccgc
ggctatctgggccgcccggcgctgaccgcggaccgcttccccgccgacccgtacgccgcc
ctcttcggcgagcgcggcacccgcatgtaccgcaccggcgacctggccaggcgccgcacc
gacggcggcctcgactacctgggccgcgccgaccagcaggtcaagatccgcggcttccgc
atcgagcccggcgagatcgaggccgtgctcgccgcccaccccgccgtcgacgacgtggcc
gtggtggcgcgcgaggacgtccagggcgacccccggctcgtcgcgtacgtggtgaccggc
tccggcgccacggcccgcgcgctgcacgaccacgcggccgggcacctgcccgaccacatg
ctgccgtcggcgttcgtcaccctggacgtgctgccgctgacgcccaacggcaagctcgac
accaaggcactgcccgccccggcccacgcggggcaggtgaccggacgcgcgccgcgcggg
ccgcgcgaggagatcctgtgcgccctgttcgccgaggtgctcggggtgccccggctgacc
gtcgacgacagcttcttcgacctcggcgggcactccctgctcgccacccggctggccggc
cgcatccgcggcaccctcggcgtggagctgtccgtgcggcggctgttcgagacccccacg
gtcgccgggctgtccgccgccctcgacggcgccgaacggtccggcaccggcccgacggcc
ggggagcgcccggagcggctgccgctgtcgtacgcccagcagcggctgtggttcctgcac
cagctggagggcccctcccccacgtacaacatcaccggcgccctgcggctgaccggcgac
ctcgaccccggggcgctgcgcgcggccttccaggacgtcgtcacgcgccacgagagcctg
cggaccgtcttctcggaggacgggcacggcgcccggcagaccgtgctcgacgccgccggt
gtgcgcttcgagctgccggtcgccgacgtgagcgaggaccggctggacgcgcgcctcgag
gaggccgcccggcactgcttcgacctgacgaccgacatcccggtgcgggcggagctgttc
cggctcggcgcgcgggagcacgtcctgctgctgatggtgcaccacatcgccggtgacggc
tggtccctcggcccgctgatccgcgacctggccgccgcctacacggcccgcgcggcccgt
cgcgcccccgactgggcgccgctgcccgtgcagtacgcggacttcgccctgtggcagcgc
gccgcgctcggggacgccgccgacgccaccagcccggcgggccggcagctcgcgcactgg
aaggaggccctggccggactgcccgaccggctggaactgcccgcggaccggccgctgccc
gccgtcgcctcgcaccgcggcggccgggtgccgctcaccgtccccgcgcccctgcacagc
ggtgtcgcggagctggccagggagtcccgcaccagcgtcttcatggtgctccaggcggca
ctggcggcactgctgacccggatgggcgcgggcgaggacgtaccgctcggcaccccggtg
gcgggccgcggcgacgacgccgtcgaccaggtcgtcggcttcttcgtcaacaccctggtc
ctgcgcaccgacaccggcggcaaccccaccttccgcgcactcctcgaccgggtccgcgac
accgacctgaccgcctacgaccaccaggacctgccgttcgagcacctggtggacgtcctc
tccccgaccaggtcgctctcccacaacccgctgttccaggtgctgctgagcctggacacc
acccagcaggacgccctggccgcgctctccgccaccggcctcggcgtgcggctgctgaac
gtcaccaccggggtcgccaagctggacctcgccctggagatcgccgagcaccgcgacgcc
gacggcgcccccgccgggctggtgggcgcggccgagtacagcgcggacctcttcgacgag
ggcaccgtcacgctgctggtggagcggttcctgcggcttctggacgcgctggtcgcggac
ccgtcccggcgcatcggcgacgtcgacgtgctcggcccccgggaacgggagcgggtcctg
accgagtggaacgacaccccccgccggccggtgcagggcaccttcgccgaccacgtcgcc
cggcacgccgccgagcgccccggccacctcgcggtcgagacggccggcgccgcggcgccc
ggcggcgcgctgacctacggcgaactgaacgagcgcgccaaccggctggcccgcgccctg
ctcgcgcggggcgcgggcccggagcggttcgtggcggtcgccctgccccgctccgccgac
ctggtcctctcggcgctcgccgccttcaaggcgggcgcggcctacctgcccgtggacccc
gcgcaccccgccgaacggatcacccacctcgtctcggacgcggcgcccaccctcatcgtg
accacgtccgccctggccgcgagcctcccggacaccggcacgccggtcctcctgctcgac
acccccgagaccgccgcgaccctcgccgcactccccggccacgacgtcaccgacgccgac
cggccggtaccgctgcgccccgagcaccccgcgtacatgatctacacctcgggaacgacc
ggccgccccaagggcgtcgtcgtcacccacaccgggctgcccggcctcctggacatcttc
acccgcgactgcgcggccggcccgggcagcaggatcctccagcacctctccccgagcttc
gacgcctcgttctgggagctggcgatgggcctgctcaccggggccaccctggtcgtggcg
ccgccggagaccacgccgggaccggagctggccgagctggcgacccggcacgcggcgacc
cacctgagcctgaccacgtccgtcctcgggctcctgccgccggactcgctgcccgacgga
ctgaccctcgtcgtgggcgccgaggccatcccgcccgagctggtggagcgctggtcgccg
ggccgtacgatgctgaactcctacgggcccaccgagaccaccgtctgctccaccatgagc
ggcccgctgtccggccccgccgtcccgcccatcggctcccccgtcgccaacagcgccgtg
tacgtgctggacgcggcgctgcgtccggtcccgcccggcgtgcccggcgagctgtacgcg
gccggagcgcatctggcccgcggctaccacgaccgccgggcgctgaccgccgaacggttc
gtggccaaccccttcggcgagcccggcagccggctctaccgcaccggcgacctggtccgc
tggcggcccgacggacagctggagtacctggggcgcgccgacacccaggtcaagatccgc
ggcctgcggatcgagcccaccgagatcgaggcggtcatcaccgaacgcccgcacctggcg
cgggcggccgtgatcgtacgcgaggaccggcccggcgaccggcggctcgtcgcctacgtc
gtgcccgagcccggcgccaccgtggacaccgccgaactccgcgccgcactgcgcgagacc
ctgcccgaccatatgatcccgaccgcgttcgtggtgctggacgcgctgccgctgaccctc
aacggcaagctggaccgcaaggcgctgcccgcccccgactactccgcccgcacctccggc
cgggccgcccgcgacccgcgcgagcggctgctgaccgcactgttcggcgagatcctcggc
gtggagccggccggcgtcgacgacggcttcttcgacctgggcggggacagcatcctctcc
atccagctcgtcgcccgcgcccgcgcggcgggcctggtcctgtcggtgcgggacgtcttc
gaacaccagacgcccgcgctgctcgcccggtcggccgccgccgcacccgccggggaccgc
acggcgcgggactccgacgtgcccgccgacggcccggcgccgcgcaccccgatgatgggc
tggttcgccgctctcggctccgacctggccgcgttcaaccagtcgctggtcctgcgcgtg
cccgccgccctcgaccccgacacgctcgacaccgccctgcgggccgtgctcgaccggcac
gacgcgctgcgcatgcgggtggccgacgactggaccatcgagatcccgccgcccggctcg
gtgaccccggccgactgcctggtccgcttcgacgccgtaggcctcgacgaggccgccgtg
cgctcggcggtcaccgagcaggcacggacggcccgcgaccggctggccccggcggacggc
cgcatgctccaggccgtctggctcgaccgcggcgccgaccgggacgggctgctcctcctg
gtcgccaaccacctggtcgtggacggcgtcacctggcgcatcctggtccccgacctggcg
gccgcctacgcgggcgagaccctcgccccggtgggcaccccgtggcggcactgggccctg
tccctctccgacctcgccgggcagccgcgaaccgaggaggagctggaccactggcactcg
gtcctcggcgacaccccgcacacgctccgcctggaccccgcgcgggacacccacgcgacc
gccggcgagatcaccgccgaactcgacgcagacaccaccgaggccctgctcacctgggtc
cccggcgtctgccacgccacggtcaacgacgtgttcctgagcaccttcgccctggccgtc
gccgggtggcggcgcgggcgcggcgaggacgccgacgcacccgtcgtgctcgacctggag
agccacggccgccacgaggaggcggtcccgggcgtcgaactcagccgcacggcgggctgg
ttcacgtcgatgtaccccgtccgtctcgcaccacccgccggcgcctccggggacggatcg
gcgctccgcgcgctgaaggccgtcaaggagcagctgcgcaccgtcccgggcgacggcctc
ggctacggcctgctgcgccacctcaacccccgcacccgggccgccctcgccgccctgccc
ctccccgagttcggcttcaactacctcggccggatcggccaggagggcaccgacgaggcc
ccctggaccatcgagggcggcgacgtcgccggtatcgacggtgccatgccgctggcccac
cccgtggacgtgaacgccgtcgcccgggagaccgccgacggcacccggctgcgcgcccgc
tggacgtactcccgcacagcgctggagcccgaggacacccagcggctggccgacacctgg
ttccggctgctgcgccgcctcgtcgaggaggcccggcagcccggcgcgggcggcctcacc
ccctccgacatcgctcaccccgccctcgcccaggacgagatcgaggacctggagcacacc
gtccccggcctccaggacatcctgcccctcgcccccctccaggagggcttcctcttcctc
aacctgtacgacgagaacgcccgcgacgtctacgtcggccagctcgccttcgacctggag
ggctccttcgacggcacccgcatgcgcgcggcggccggggccctgctgcgccgccacgcc
aacctgcgggccgggttccggcagacggcgaccggcacgtgggtgcaggtcgtgcccgcc
gagctcgaaccggactggcgggagtgcgacctgaccgaccgcgccgacgaggcggaacgg
gacgcggaggccgggcggctggcggccggggaccgcgaacgccgcttcgacctcaccagc
ccgccgctgatgcgcttcaccgcgatccggctgtccgccgaccgcgtccggctggtgatg
accaaccaccacatcctgctcgacggctggtccatgcccctgctctggcaggaactgacc
gagctgtacgtctccggcggcgaccccgtgagcctccccccggtccgcccgtaccgcgac
cacctggcctggctcggcgcccgcgaccgggacgccgcccgcgacgcctggcggcggtcc
ctgtccgggctcgacgaggccaccctcctcgccccggacgccggcccggccgaggcggca
ccgctgggcatcccgttcggcctggaccgtgacgccacggcggccctgtccgcgtgggcg
cggggtcggggggtgaccatgaacacggtggtccagggtgcctgggccctcgcgctggcc
caggccaccggacgcgacgacgtcgtcttcggcgccaccgtctccggccgcccgcccgag
ctgcccggcgtcgagtccatgatcggcctgttcatcaacaccctgcccgtccgcgcccgc
ctcgaccaggccgaacccctcggcgacctcttccgccgcctccagaacgaacaggcccgc
ctcctggaccaccagtggcccggactcgccgacatccagcactgggccggacacggcgaa
ctcttcgacaccgccatggtcttccagaactacccggtgagcgccgacacgacgagccga
cagctcgacggactgcgggtggccggttacgacgcggtcgagagcaccgacttcgccgtc
aacctcgtcgcccacacccgcgacgacgccctgcggctgcgcctcgactaccgcgcggac
gcctgcgccggcgacctggtccgctcactggcggaccggatgctgcgggtcctggaagca
ctggtcaccgactcggaccgtcccgtggcccacctggacaccctcgacccggccgtacgg
gagcgggtcctggtggagtggaacggggccccgacccagcttcccgggacaccgctgcac
gaactgatcagcgagcaggcccggttgacgccggacgccgtggcggtggtgtgcgacggg
acctccctgacctacgccgagctggacgggggcgccaaccagctcgcccggcacctgctg
ggagaaggcctcggtgcggaggacttcgtcgcgatcgccctggccaagtcgctggacgcg
gtgatcagcatgctggccgtgctcaagaccggcgcggcctacctgcccatcgacccggac
taccccgccgaacgcatcacctacatgctcgacgacgcccgacccgccctgaccctgacc
gagccggtacccgtggagaggtacacggggcactccgtcacggcagtcacggatgaggag
cgccgtagcccctggtcggcacgccatgccgcgtacatgatctacacctccggctcgacc
ggccgccccaagggcgtcgtcatcgagcaccacgccctggccacctacctccaccgcgcc
cgcaacacctacaccgccatgaccggtgtgaccgtcctgcactccccgctggccttcgac
ctcaccatcaccgccctgtggacgccattgacaagcggcggcacggtccacctcaccagc
ctcgaagagtcggacacgcaaccgagcctgatcaaggccacacccagccacctccccctg
ctcaccacactccccgagacggcgtccccgtcccacaccctcatcctcggcggcgaagcc
ctccacaccgaccacctcgtcacctggcggacccagcaccccggcgttcagatcatcaac
gcctacggacccaccgaatccaccgtcaacatcaccgaccaccacgtaggcgaagacacc
cctgacggtcccgtccccatcggacggcccttcgccaacacccaggtctacgtcctcgac
tcggccctgcgccccgtcgcccccggcgtcaccggagagctgtacctcgccggtgaacag
ctcgcccgcggctacctcggccgccccgcgctgaccgccgaacgcttcaccgccaacccc
cacagcagcacccccggcgcccgcatgtaccgcaccggtgacctcgcccactggaaccac
cacggccacctcacctacgacggacgcgccgaccaccagatcaaactccgcggccaccgc
atcgaacccggtgagatcgaagccaccctcaccgcacagaccggcatcacccaagccacc
gtccaactccgtgaggaccagccgggcgaccagcgcctcgtcgcctacctcgtcgtcaac
gactccaccgaatacgacgagaaaaccgtgcgcgacgcactcacgagcgcactgcccgac
tacatggtccccagcgcactcgtcaccctcgacgccctccccctcacccccaacggcaaa
ctcgaccgcaccgccctccccgcccccgcctactcggcatccaccgccggacgagcacct
cgcaccccccgcgaagaagtcctctgcaccctcttcgccgaagtcctcggcgtcgacctc
gtcaccatcgacgacaacttcttcgacctcggcggacactccctcctcgccacccgcctc
gtctcccgcacccgcaccgcactcggcgtcgaactgtccatccggcagctcttcgagacg
ccgaccgtggcgggtctcgccgaggccctcgacgcgtcgggcaccgtccgcaccgcgctc
accgcgaggccgcgccccgagcgcatcccgctctcctacgcccagcaacgcctctggttc
ctccaccagctcgaaggaccatcggcgacctacaacaccgtgctcacgctgcggctcggc
ggcgcgctcgacgtggacgccctgcgcgcggcgatcagtgacgtcgtcgcccggcacgag
agcctgcggacggtcttcaccgaggacgagcgaggcgcgtaccagatcgtgctgcccgtg
gaggctgcctcgacgcccttcaccgtcgtcgacgtggccgaggaggagatcggcgaccgg
ctcgacgaagccgtcggccactgcttcgacctcgcccaggaacttcccgcgcgcacctcg
ctgttccgggtgtcggagcgggagcacgtactgctgctcctcatccaccacatcgccagt
gacgcctggtcccgcgccccactggcccaggacctcaccgccgcctacgcggcccgcgtc
cgcagcgaggcgcccatgtgggccccgctcaccgtccagtacgccgactacgcgctctgg
cagcaggagatcctcggcgacgacaccgatgccgacagcctcgccggccgccagctcgcc
tactggaaacagcagctcgccggcctgcccgaacagctcgacctccccaccgaccggccc
cgaccggcggtcgcggggtactcgggggaccgtgttccgttcaccgtgccgacggagctg
cacacgcggctgacggagctggcgcgcgccaccaacaccagtgccttcatggtgatccag
gctgcggtcgccgtcctgctcacccgtctgggcgccggtgaggacatcccgatcggcacc
cccgtcgccggacgcacggacgacgccgccgacgacctgatcgggctcttcatcaacacg
ctggtcctccgcaccgacacgtccggtgatccgaccttccgccgactcctcgaccgcgtg
cgggacaccgacctggccgcctacgcgcaccaggacctccccttcgagcggctggtcgag
gcgctgaacccggcacgcacgctgtcccatcacccgctcttccaggtcctgctgacgttc
aacaacacggaccacgaaggcgcgctgaaggacatctccgagcttccggggctcaccgtc
gcacttcgggaggtccagcggacctcgtcgaagttcgacctctccttcgggttcgcggag
tccttcgacacgtctcgtcggccacaaggcatcgaagcggcactggacttcagtacggaa
cttctcgaccgccggtccgcccaggcgatcgcggaccggttcctgcgggtgctggaagcc
gtcaccacagccccggaccggccgatcggcgccgtcgagctgatggacccggccgagcgg
gagcgggtcctggtggagtggaacggggccccgacccagcttcccgggacaccgctgcac
gaactgatcagcgagcaggcccggttgacgccggacgccgtggcggtggtgtgcgacggc
accaccctgacctacgccgagctggaccggcgcgccaaccagctcgcccggcacctgctg
ggagaaggcctcggtgcggaggacttcgtcgcgatcgccctggccaagtcgctggacgcg
gtgatcagcatgctggccgtgctcaagaccggcgcggcctacctgcccatcgacccggac
taccccgccgaacgcatcacctacatgctcgacgacgcccagccggccctgaccctcacc
gcgcccataccgcccgcttcgtacgacagccggcccaccagcgagatcaccgatgtggag
cgccgtagcccctggtcggcacgccatgccgcgtacatgatctacacctccggctcgacc
ggccgccccaagggcgtcgtcatcgagcaccacgccctggccacctacctccaccgcgcc
cgcaacacctacaccgccatgaccggcgtgaccgtcctgcactccccgctggccttcgac
ctcaccatcaccgccctgtggacgcctctcaccgccggcggcacggtccacctgaccagc
ctggaggaggctgaggtccagcccagcctgatcaaggccacacccagccacctccccctg
ctcaccacactccccgagacggcgtccccgtcccacaccctcatcctcggcggcgaagcc
ctccacaccgaccacctcgccacctggcgcacccagcaccccggcgcccagatcatcaac
gcctacgggcccaccgaatccaccgtcaacatcaccgaccaccacgtaagcgaagacacc
cctgacggtcccgtccccatcggacggcccttcgccaacacccaggtctacgtcctcgac
tcagccctgcggcccgtcgcccccggcgtcaccggagagctgtacctcgccggtgaacaa
ctcgcccgcggctacctcggccgccccgccctcaccgccgaacgcttcaccgccaacccc
cacagcagcacccccggcgcccgcatgtaccgcaccggcgacctcgcccactggaaccac
gacggccacctcacctacgacggacgcgccgaccaccagatcaaactccgcggccaccgc
atcgaacccggcgagatcgaaaccaccctcaccgcacagaccggcatcacccaaaccacg
gtccaactccgcgaagacacccccggcgaccaacgcctcgtcgcctacctcgtcgtcaac
gactccaccgaatacgacgagcccacccttcgggacgccctggccagcgcactccccgac
tacatgcgcccctccgcctacgtcaccctcgacgccctccccctcacccccaacggcaaa
ctcgaccgcaccgccctccccgcccccgcctactcggcatccaccaccggacgaaccccc
cgcaccccccgcgaagaaatcctctgcacactcttcgccgaagtcctcggcgtcgacctc
gtcaccatcgacgacaacttcttcgacctcggcggacactcgcttctcgccacccgcctc
gtcagccgcgcccgcaccgcactcggcgtcgaactgtccgtgcggcagttcttcgagacg
ccgacgatcgccgggctctcgggggcgttcgaccgggccggccgtgcgcgggccgcgctc
acggcgaggccgcgccccgagcgcatcccgctctcctacgcccagcaacgcctctggttc
ctccaccagctcgaaggaccatcggcgacctacaacatccccaccaccctccgcctcacc
ggcaccctcgacaccgacgccctgcaatccgcgctcaacgacctcctcgcccgccacgaa
agcctgcgcaccacctacaccgaggacggcgaaggcccccgtcaggtgatccacgcctgg
gagcccggaatgctgccgctcggcgtggtcgacaccggggagggcgagctggacgcgatg
ctctccgcgggggttcatcacgcgttcgacctcacggcgggcatcccggtgcgggccacg
ctgttccggatctcggagcaggagcacgtactgctgctcctcatccaccacatcgccacc
gacgcctggtcccgcaccccgctgggtcacgacctcgccgccgcctactcggcgcgctgt
gcgggcgacgtgccggcgtgggagccgctgcccgtgcagtacgccgactacgcgctctgg
cagcgggaggttctcggcgacgaaggcgacgccgacgcccccgcgggcaggcaactcgcc
tactggacacggcagctcgccgacctgcccgagcagctcgacctccccaccgaccggccc
cggccggccgtggcgagccaggacggcgaccgcgtcgccttctcgctcgacgcggacctg
tacgtgcggctgaccgagctggccagggccacccactcgagtacgttcatggtggtgcag
gcggcgctcgccgtactgctgacccggctgggcgcgggcgaggacatcccgatcggcacc
ccggtcgccggacgcaccgacgacgcgacggagaacctggtcggcttcttcgtgaacacg
ctcgtcctgcgcaacgacaccagcggcaaccccaccttccgggagctgctggaggagacg
cgccgcaccgacctggccgcctacgcgcaccaggacctccccttcgagcggctggtggag
gcgctgaacccggcccgtactctggcgcaccacccgctcttccaggtgatgctgatcctg
agcacggcggagacggacccggacgcctcgctggcactgccgggactgcgggtcggcgcg
gagcgcagccggctcggggcggccaaggtcgacctggcgttcgcgctcgccgaggtccgg
gacggtgagggccggagcaccgggctgacgggcgcgctggacttccggaccgacctgttc
gaccgttccacggcccggtccctggtggagcggttcgtgcggacgctggaggcggtcgtc
gccgatcccggtgtgcggctgtcccgggtgccggtgctgaccgggtccgaacggcgctcg
ctgctcgaccgggggaccggtcccctgctggaggggctggacgcgacgctgccggaactg
ttcgcggagcaggcgctccggacgcccggggcaccggcgctggtgcggggcgggacgacg
gtgtcgtacgccgaactcgacctgcgcaccaaccggctggcccggctgctgcggcagcag
ggggtgcggccgggcacgccggtggtcatgctgatggagcggtcgcccgcccatgtcgtg
gcgacgctggccatcgccaaggcgggcggcgcctacgtgcccctgcacgacacgtatccc
ctcgaccggatgcggcacgtggtggcggacaccgccgcgacgctgatcctcaccgaccgg
gccgaggcggcgcgggccgggcagctcggcgcgcgggtgatggtggtcgacgagttcggc
gccgccccgtccggctcggaggccgacgcggcccccggcaccggcaccggcaccggcacc
ggctcgcgctccgggtacgtcgacgatgctccggaggtgggcctgcgcccgcaggatctc
gcgtacgtgatgtacacctccgggtccaccggggtgccgaagggcgtcgcggtcacccac
cgcggggtcgtggacctggtccgcgaccactgctggcggccgggcgtccacgagcgggtg
ctgctgcacgccccgcacgcgttcgacgtgtcctgctacgagatgtgggtgcccctggtc
tcgggcggaacggtcgtcgtggcaccgcccggacacctggacccggccgcgatcaccgac
ctgatcaccgctcacgacatcaccgcgatccacctcaccgcgggcttcttccgggtcgtc
gcggaggaggcaccggagtgcttcgccggtgtgcgggaggtgctgaccggcggcgacgtg
gtctcgccagccgcggtggcccgggtcctcgcgcaccacccgcggatcgtactgcgtcac
ctgtacgggccgaccgagacgacgctgtgcgtgacgcagcacgaggtcaccgcgccgtac
gaggcccgcggcagcctgccggtcgggcgggcgacggggaacacccgggcctacgtgctc
gaccggtacctccagccggtgccggccggcgtgccgggcgagctgttcatctccggctcc
ggtctggcgcgcggctacctggaccgtcccgacctgacctgtgagcggttcgtcgccgat
ccgtacggcgggtccggcgagcggatgtaccgcacgggcgacctggtccgctacaacgcg
gcgggcgaactggagtacctggcccgcgccgacgaccaggtcaagatccgcggcttccgg
gtggaactgggcgagatcgaggcggtcctggccacgcgcccggagctggcccaggccgcc
gtcgtcgtccgcgaggaccggcccggcgaccggcgcctggtcggctacgtggtggccgcg
gcgggccgggacggcgaggtcgacccggacgcgctgcgcgccttctcccgccaggcgctg
ccggactacatggtgccgtcggcgttcgtggtcctcggcaccctgccgctgaccgccaac
ggcaaactggaccgcaaggcgctgcccgcgcccgactacggggcggcgtccaccgggcgg
gccgcccgcacccctgccgaggagctgctgtgcacgctcttcgcccaggtgctcggcctg
tccgcggtgggcgtcgacgacgggttcttcgatctgggcggcgacagcatcctgtccatc
cagctcgtcagccgggcccgcgccgccggactcgccctcgccgtccgcgacgtcttcgag
caccagtcgacggcccggctggccgccgcgctgacggaccgggacgacgcggcctccgtg
ccggaggccgaagcggtgccgccgtacggtcccgccccgctgacccccgtgatggcccgc
atcgccgaactgggcctgggcggagacgacttcaaccagtcggtcgtggtgtccctgccg
cccgcggtggaccgggaccggctcgtcccggccctgcaacgtgtgctcgaccaccatgac
gcgctgcgcctgcgcgtcctgcccgacgggagcacggaggtacgcgccccgggcagtgtg
ccggccgcggacgtcctgagcgtcgtcacgcgggcccccggcgccaccggcgaggcgcgc
gacgccctgctcgtggaggcggcgtgcgccgcacgggaccggctcgcaccggccgagggc
cgcatgctccaggcggtcctggtcgacggcacggacgacacggacggcacgggcgggacc
tccggggcggacggcgtgctgatcctggtcgcccaccacctggtggtcgactcggtgacg
tggagcatcgtcgtaccggacctcgccgcggcctaccggggcgaggagcccgccccggtg
ggcacctcgtggcggcagtgggccacctccctggcacggctggccaccgacccccgcgtc
gaggcggagaccgcccactgggagcacacgctcaccggggcgggcaccctgcggctggac
cgcggccgcgatctccagggcgacgccggacgcatcagcctcgacctggccccgcacacg
accgaggccctgctcacgcgcctgcccgggggcgtcaacgcgagcgtgcacgacgtcctg
ctgaccgccttcgcgttcgccgtcgccgggtggcggcgcggacgcggcgaggacccggac
gcgcccgtcgtgctcgacctggagagccacggccggcacgaggaggcggtgccgggcgcc
gaactcagccgcacggcgggctggttcacggccctccacccggtgcggctggctccggac
gtcaccgactgggcgcggctgcaccaggacggcgacgcgctccgggacggcctcaagcag
gtgaaggaacagttgcggtccgtaccgggcgacggcctcggccacggcttgctgcgccac
ctcaaccccaccgctgggccccgcctcgcacgccttcccgagcccgacttcggcttcaac
tacctgggccgccgggtcaccccggccaccggcaccccggaaccgtggaccgtcacgggc
ggcggcctcgccgcctcgcggcccacggcgccgatggcccacgcggtggagctgagcgcc
gtcgtccacgagggggcggacggcccccgactgcgcgcggagtggacctacgcacgccgc
ctggtccccgatcacgacgcccgccgcctggccgagcaatggttccgggcgctggaagcc
ctggtggagcaggccgaccgggccggcaccggcggcctgaccccgtccgacgtgaccctc
ggctcgctcagccagtccgagatcgaggaattcgagtccgaccttgagtccgagtgggag
attgagcagtga

DBGET integrated database retrieval system