KEGG   Streptomyces coelicolor: SCO3236Help
Entry
SCO3236           CDS       T00085                                 

Gene name
SCE29.05c
Definition
(RefSeq) oxygenase
  KO
K18058  
L-asparagine oxygenase [EC:1.14.11.39]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.39  L-asparagine hydroxylase
     SCO3236 (SCE29.05c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3587687..3588688)
Genome map
AA seq 333 aa AA seqDB search
MAANAAGPASRYDVTLDQSDAELVEEIAWKLATQATGRPDDAEWVEAARNAWHAWPATLR
RDLAGFRRDSGPDGAIVLRGLPVDSMGLPPTPRVNGSVQREASLGAAVLLMTACGLGDPG
AFLPEKNGALVQDVVPVPGMEEFQGNAGSTLLTFHNENAFHEHRPDFVMLLCLRADPTGR
AGLRTACVRRVLPLLSDSTVDALWAPEFRTAPPPSFQLSGPEEAPAPVLLGDRSDPDLRV
DLAATEPVTERAAEALRELQAHFDATAVTHRLLPGELAIVDNRVTVHGRTEFTPRYDGTD
RWLQRTFVLTDLRRSRAMRPADGYVLGAAPQPA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaatgccgcgggaccggcgtcgcgctacgacgtgacgctggatcagtcggat
gcggaactcgtcgaggagatcgcctggaaactcgccacgcaggcgaccgggcggcccgac
gacgccgaatgggtcgaggcggccaggaacgcctggcacgcctggccggcgaccctgcgc
cgggacctcgccggattccgccgggactcgggaccggacggcgcgatcgtgctgcgcggt
ctgcccgtcgactccatggggctgccgccgaccccgcgggtcaacggctccgtgcagcgc
gaggcctcgctgggcgccgccgtgctgctgatgaccgcctgcgggctcggcgaccccggc
gcgttcctgccggagaagaacggcgccctcgtacaggacgtcgtccccgtgccgggcatg
gaggagttccagggcaacgccggttcgaccctgctgacgttccacaacgagaacgccttc
cacgagcaccgccccgacttcgtgatgctgctgtgcctgcgcgccgaccccacgggccgg
gcgggcctgcgcaccgcgtgcgtgcggcgggtgctgccgctgctgtccgactccaccgtg
gacgccctgtgggcaccggagttccgcaccgcgccgccgccctccttccagctgagcggc
cccgaggaggcacccgcaccggtactcctcggcgaccgttcggaccccgacctgcgggtg
gacctggcggccaccgagccggtgaccgagcgggccgccgaggccctgcgcgaactccag
gcccacttcgacgccaccgccgtcacccaccgcctcctgcccggggagctggcgatcgtg
gacaaccgcgtcaccgtgcacggccgcaccgagttcaccccccgctacgacggcaccgac
cgctggctccagcgcaccttcgtgctcaccgacctgcgccgctcgcgcgcgatgcggccg
gccgacggctacgtgctcggagcggccccgcagcccgcctga

DBGET integrated database retrieval system