KEGG   Streptomyces coelicolor: SCO3245Help
Entry
SCO3245           CDS       T00085                                 

Gene name
SCE29.14c
Definition
(RefSeq) salicylate hydroxylase
  KO
K00480  
salicylate hydroxylase [EC:1.14.13.1]
Organism
sco  Streptomyces coelicolor
Pathway
Dioxin degradation
Polycyclic aromatic hydrocarbon degradation
Naphthalene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCO3245 (SCE29.14c)
  Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    SCO3245 (SCE29.14c)
   00626 Naphthalene degradation
    SCO3245 (SCE29.14c)
   00624 Polycyclic aromatic hydrocarbon degradation
    SCO3245 (SCE29.14c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.1  salicylate 1-monooxygenase
     SCO3245 (SCE29.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3596708..3597970)
Genome map
AA seq 420 aa AA seqDB search
MPKLRIAVVGGGIGGLAAALALTRKGHEVRVYEQAPELREAGVGMHLGPNGSRLLERWGL
GERLRALGVRPAGMEVRDWSHGGTLVRQPMGEEWLAEFGAPYYTIHRADLHTMLAESLPS
GTVRAGHRLERFTETGGGVRLEFADGSTAGADVLIGADGAHSVVRRTLAGPDTAVFSGQS
AFRGVVARDQVPGLPGDTLLVWAGPDARMLVYPVRGGRFLTFVAVVPDPRWRLESWSAPG
DLDELAARFDGWNTDVKSLVAAVRESRRWALYDREPLARWSAGAVTLLGDAAHPMLPHHG
QGVSQAVEDAAVLAHCLDAPTGPDPSASVSAAAAASAPAAAAASAPAARRAIAAALDAYE
GVRRPHTTRVQLGSRGGGSQRLRPDEDGTESTGTMSSLVEDVSWIQRHDAEAGLPPLPPP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaagctgcggatcgcagtcgtcggcgggggcatcggcggactcgccgccgccctc
gccctgacccggaagggccacgaggtacgcgtctacgagcaggcgccggaactcagggaa
gcgggcgtgggcatgcacctgggccccaacggcagccgccttctggaacgctggggcctc
ggcgagcggctgcgcgccctcggtgtacggcccgcgggcatggaggtgcgggactggtcg
cacgggggcaccctggtgcggcagccgatgggcgaggaatggctcgccgagttcggggcg
ccgtactacacgatccaccgggccgacctgcacaccatgctcgccgagtcgctgccctcc
ggcacggtgcgggccgggcaccggctcgaacggttcaccgagaccgggggcggggtccgg
ctggagttcgccgacggctccaccgccggcgcggacgtcctgatcggcgcggacggggcg
cactccgtggtgcgccgcaccctcgccgggcccgacaccgccgtcttctccggccagagc
gccttccgcggcgtcgtcgcccgcgaccaggttcccggcctgcccggtgacacgctcctg
gtgtgggcgggaccggacgcccgcatgctggtctacccggtgcgcggcgggcggttcctc
accttcgtcgccgtcgtgcccgacccgcggtggcgcctggagtcctggagcgccccgggc
gacctggacgaactggccgcccgcttcgacggctggaacaccgacgtcaagtccctggtg
gccgcggtgcgggagtcccggcgctgggcgctgtacgaccgtgagccgctggcccgctgg
agcgcgggcgccgtcaccctgctcggcgacgcggcccacccgatgctgccccaccacggc
cagggcgtcagccaggccgtcgaggacgcggcggtcctcgcacactgcctggacgccccg
acgggcccggacccctcggcctccgtatccgccgcagccgccgcctccgctcccgccgca
gccgccgcttccgctcccgccgcccggcgggcgatcgcggccgcgctggacgcctacgag
ggtgtccgcaggccgcacaccacccgggtccaactcggctcgcggggcggcggctcccag
cggctgcggcccgacgaggacgggaccgagtccacgggcacgatgtcgtccctcgtcgag
gacgtgtcctggatccagcgccacgacgccgaggccggcctcccaccgctgccgccgccg
tag

DBGET integrated database retrieval system