KEGG   Streptomyces coelicolor: SCO3247Help
Entry
SCO3247           CDS       T00085                                 

Gene name
SCE29.16c
Definition
(RefSeq) acyl CoA oxidase
  KO
K00232  
acyl-CoA oxidase [EC:1.3.3.6]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCO3247 (SCE29.16c)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO3247 (SCE29.16c)
   00592 alpha-Linolenic acid metabolism
    SCO3247 (SCE29.16c)
   01040 Biosynthesis of unsaturated fatty acids
    SCO3247 (SCE29.16c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     SCO3247 (SCE29.16c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3599006..3600808)
Genome map
AA seq 600 aa AA seqDB search
MTQREEELARVLSGPEFATIRPDDLSVLDYSLLTLRRARLLNGAGFAANSLWLGRGDSAR
FPEFLRTMGWIGAYDLSLLNVLVSHQIAGDALLSHGGPEQLDAWAGEIDAMERMYCFAGS
ELLAGSDLKRVRTTAVYDPHGRSLVLNTPRPADSKVWTGNSLHTGDVAMVLARLEVGGRD
EGHHWLRVPLREAGAVLPGVRIGRAEPKGGVTANQTGVLTFTDHRLPLSALMNRWASIDE
DGTYRSPLPRHRRFEECLATFTHERLFPSVGAAYAQLLACTITTRFAAVKQTFGRPLIGH
EHYRMRLSAAVGRSLAARHAMTALAEVAVARSAEGAPARDQVLHALISCGKSGCTGDARQ
TLAETRELCGGLGYHDANQIAPLLHDYEIAVTFGGDNTVLGYQATRFALRHREDFDRVLD
EAVAGAGRLDAVRVLRAVCDVLLDRVERDGAGEASAQWSRAVHQTLAIGHWARQASTPLS
ERLLAQYAAVCVLEHALAALRAGILDQDALLGFEAARHEAAGAPLDADALLRELAVPEGL
ISAPIAHPDFAERHAAAAHAGTAAAHAGTVPSPGTGPSPGTGPAPGTVQAPGTVQAGVRP
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacgcgaagaagagctggcccgtgtcctctccgggcccgagttcgccaccatc
cgaccggacgacctgagcgtcctcgactacagcctgctgacgctgcgccgggcgcggctc
ctcaacggcgccggtttcgcggcgaactccctctggctgggccggggcgacagtgcccgc
ttcccggagttcctgcgcaccatgggctggatcggcgcgtacgacctgtccctgctcaac
gtcctggtctcgcaccagatcgcgggcgacgcgctgctcagccacggcggtccggagcaa
ctggacgcctgggctggggagatcgacgcgatggagcggatgtactgcttcgccggttcc
gaactcctcgccggctcggacctgaagcgggtgcggaccaccgcggtctacgacccgcac
gggcggagcctggtgctgaacacgccccggcccgccgacagcaaggtgtggaccggcaac
agcctgcacaccggcgacgtggccatggtgctggcccggctggaggtcggcgggcgcgac
gagggacaccactggctgcgggtaccgctgcgcgaggccggggccgtactgcccggcgtg
cgcatcggccgggccgagccgaagggcggtgtcacggccaaccagaccggcgtactgacc
ttcacggaccaccggctgccgctgtccgcgctgatgaaccgctgggcgtcgatcgacgag
gacggcacctaccggtccccgctgccgcgccaccggcggttcgaggagtgcctggccacc
ttcacccacgagcggcttttcccgtcggtgggagcggcgtacgcgcaactgctcgcctgc
acgatcaccacgcggttcgcggccgtcaagcagaccttcggcaggccgctgatcggccac
gagcactaccgcatgcggctgtcggcggccgtggggcgctcgctggccgcccggcacgcc
atgacggcgctggccgaggtggcggtggcccggagcgccgagggagcaccggcccgcgac
caggtgctgcacgccctgatctcgtgcggcaagtccggctgcaccggcgacgcccggcaa
acgctggccgagacccgggagctgtgcggcgggctcggctaccacgacgccaaccagatc
gcgccgctgctgcacgactacgagatcgcggtcaccttcggcggtgacaacaccgtcctc
ggctaccaggcgacccggttcgccctgcgccaccgcgaggacttcgaccgggtgctggac
gaggcggtcgccggggccggacggctggacgccgtccgggtgctgcgggccgtctgcgac
gtcctgctcgaccgggtggagcgggacggcgccggtgaggccagcgcgcagtggagccgt
gccgtccaccagacgctggcgatcggccactgggcccggcaggcatcgaccccgctgtcc
gagcggctgctcgcgcagtacgcggcggtctgcgtgctggaacacgcgctggccgccctg
cgggccgggatcctcgaccaggacgccctcctggggttcgaggcggcccggcacgaggcg
gcgggcgcccccctcgacgccgacgcgctgctgcgcgaactggccgtgcccgagggcctg
atcagcgccccgatcgcccacccggacttcgcggaacggcacgccgccgcggcccatgcc
ggcaccgccgcggcccatgccggcaccgtcccgagcccgggtaccggaccgagcccgggt
accggaccggccccgggcaccgtgcaggcccccggcaccgtgcaggccggagtacgcccg
tga

DBGET integrated database retrieval system