KEGG   Streptomyces coelicolor: SCO3337Help
Entry
SCO3337           CDS       T00085                                 

Gene name
proC, SCE7.04c
Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  
pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO3337 (proC)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCO3337 (proC)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SCO3337 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3694063..3694917)
Genome map
AA seq 284 aa AA seqDB search
MTPDHAHTPEGTEPMTQKVAVLGTGKIGEALLSGMIGAGWAPADLLVTARRRERADELRA
RHGVTPVTNAEAAKAADTLILTVKPQDMGTLLDELAPHVPADRLVISGAAGVPTSFFEER
LAPGTPVVRVMTNTPALVDEAMSVISAGTHATAAHLTHTEEIFGAVGKTLRVPESQQDAC
TALSGSGPAYFFYLVEAMTDAGILLGLPRDKAHDLIVQSAIGAAKMLRDSGEHPVKLREN
VTSPAGTTINAIRELENHGVRAALIAALEAARDRSRELATGTKD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccccggaccacgcgcacaccccggagggcaccgaacccatgacccagaaagtcgca
gtcctcggcaccggcaagatcggcgaagccctgctcagcggcatgatcggagccggctgg
gcccccgccgacctcctggtcaccgcccgccgccgggaacgggccgacgaactccgcgcc
cgccacggagtcacccccgtcaccaacgccgaggccgccaaggccgccgacaccctgatc
ctcacggtcaagccccaggacatgggcaccctcctcgacgaactcgccccgcacgtcccg
gccgaccgcctggtcatcagcggcgcggcgggcgtgcccacctccttcttcgaggagcgc
ctcgcgcccggcaccccggtcgtccgcgtcatgacgaacaccccggctctcgtcgacgag
gccatgtccgtcatctcggccggcacccacgcgaccgcggcccacctgacccacaccgag
gagatcttcggcgccgtcggcaagaccctccgcgtccccgagtcccagcaggacgcctgc
accgccctctccgggtcgggaccggcgtacttcttctacctggtcgaggccatgaccgac
gccggcatcctcctcggtctgccccgcgacaaggcccacgacctgatcgtgcagtcggcg
atcggcgcggcgaagatgctccgcgacagcggcgaacacccggtcaagctgcgcgagaac
gtcacgtcccccgccggcaccaccatcaacgccatccgcgaactggagaaccacggcgtc
cgcgccgccctcatcgccgccctggaagccgcccgcgaccgcagccgcgaactggccacc
ggcaccaaggactga

DBGET integrated database retrieval system