KEGG   Streptomyces coelicolor: SCO3337Help
Entry
SCO3337           CDS       T00085                                 

Gene name
proC, SCE7.04c
Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00330  Arginine and proline metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCO3337 (proC)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SCO3337 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 PDH Shikimate_DH ApbA 2-Hacid_dh_C NAD_Gly3P_dh_N IlvN
Motif
Other DBs
NCBI-GeneID: 1098774
NCBI-ProteinID: NP_627546
Kitasato: SCO3337
UniProt: Q9X8G1
Position
complement(3694063..3694917)
Genome map
AA seq 284 aa AA seqDB search
MTPDHAHTPEGTEPMTQKVAVLGTGKIGEALLSGMIGAGWAPADLLVTARRRERADELRA
RHGVTPVTNAEAAKAADTLILTVKPQDMGTLLDELAPHVPADRLVISGAAGVPTSFFEER
LAPGTPVVRVMTNTPALVDEAMSVISAGTHATAAHLTHTEEIFGAVGKTLRVPESQQDAC
TALSGSGPAYFFYLVEAMTDAGILLGLPRDKAHDLIVQSAIGAAKMLRDSGEHPVKLREN
VTSPAGTTINAIRELENHGVRAALIAALEAARDRSRELATGTKD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccccggaccacgcgcacaccccggagggcaccgaacccatgacccagaaagtcgca
gtcctcggcaccggcaagatcggcgaagccctgctcagcggcatgatcggagccggctgg
gcccccgccgacctcctggtcaccgcccgccgccgggaacgggccgacgaactccgcgcc
cgccacggagtcacccccgtcaccaacgccgaggccgccaaggccgccgacaccctgatc
ctcacggtcaagccccaggacatgggcaccctcctcgacgaactcgccccgcacgtcccg
gccgaccgcctggtcatcagcggcgcggcgggcgtgcccacctccttcttcgaggagcgc
ctcgcgcccggcaccccggtcgtccgcgtcatgacgaacaccccggctctcgtcgacgag
gccatgtccgtcatctcggccggcacccacgcgaccgcggcccacctgacccacaccgag
gagatcttcggcgccgtcggcaagaccctccgcgtccccgagtcccagcaggacgcctgc
accgccctctccgggtcgggaccggcgtacttcttctacctggtcgaggccatgaccgac
gccggcatcctcctcggtctgccccgcgacaaggcccacgacctgatcgtgcagtcggcg
atcggcgcggcgaagatgctccgcgacagcggcgaacacccggtcaagctgcgcgagaac
gtcacgtcccccgccggcaccaccatcaacgccatccgcgaactggagaaccacggcgtc
cgcgccgccctcatcgccgccctggaagccgcccgcgaccgcagccgcgaactggccacc
ggcaccaaggactga

DBGET integrated database retrieval system