KEGG   Streptomyces coelicolor: SCO3345Help
Entry
SCO3345           CDS       T00085                                 

Gene name
SCE7.12c
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO3345 (SCE7.12c)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO3345 (SCE7.12c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     SCO3345 (SCE7.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3702759..3704612)
Genome map
AA seq 617 aa AA seqDB search
MPELRSRTVTHGRNMAGARALMRASGVPGADIGRKPIIAVANSFTEFVPGHTHLAPVGRI
VSEAVTAAGGIPREFNTIAVDDGIAMGHGGMLYSLPSRDLIADSVEYMVEAHCADALICI
SNCDKITPGMLNAALRLNIPTVFVSGGPMESGRATLVDGTVRTLDLVDAMSEAVNDKISD
ADILRIEENACPTCGSCSGMFTANSMNCLTEAIGLSLPGNGSVLATHTARKTLYENAART
VLDLTRRYYEQDDDSVLPRNIATPAAFGNAMALDIAMGGSTNTILHLLAAAQEAEVSYGL
AEMDALSRSVPCLAKVAPNVAKDRTYYMEDVHRAGGIPALLGELHRGGLLNEDVHSVHSP
SLADWLKTWDVRGGSPSKEAVELWHAAPGCVRSAEAFSQSERWDTLDEDAEGGCIRSVEH
AYSKDGGLAVLRGNLAVDGCVVKTAGVDESIWTFEGPAVVCESQEEAVQKILTQQVKEGD
VVVIRYEGPKGGPGMQEMLYPTSYLKGRGLGKACALVTDGRFSGGTSGLSIGHASPEAAA
GGTIALVEDGDRIRIDIPNRSIELLVDDAELTRREQALNGVYAPKNRDRKVSAALKAYAA
MATSADKGAVRDVSKLG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgaggtcccgcacagtcacccacggccgcaacatggcgggcgcccgcgcc
cttatgcgtgcctccggtgtacccggcgcggacatcgggcggaagccgatcatcgccgtc
gccaacagcttcacggagttcgtgccgggccacacgcacctggcccccgtcggccgcatc
gtcagcgaggcggtcaccgcggccggcggcatcccgcgcgagttcaacacgatcgccgtg
gacgacggcatcgccatgggccacggcggcatgctctacagcctcccctcccgcgacctg
atcgcggacagcgtggagtacatggtcgaggcgcactgcgccgacgccctgatctgcatc
tccaactgcgacaagatcaccccgggcatgctcaacgcggcgctccgcctgaacatcccc
acggtcttcgtctccggcggacccatggagtccggccgcgccaccctggtcgacggcacg
gtccgcaccctcgacctggtcgacgcgatgtcggaggcggtcaacgacaagatctccgac
gcggacatcctccgcatcgaggagaacgcctgcccgacctgcggctcctgttccggcatg
ttcaccgccaactcgatgaactgcctgaccgaggccatcggcctctccctgcccggcaac
ggctcggtcctggccacccacaccgcccgcaagacgctctacgagaacgccgcccgcacg
gtgctcgacctgacccgccgctactacgagcaggacgacgactcggtcctgccgcgcaac
atcgccacccccgccgccttcggcaacgccatggcgctggacatcgcgatgggcggctcc
accaacacgatcctgcacctgctggccgccgcccaggaggccgaggtctcctacggcctc
gccgagatggacgccctctcgcgcagcgtcccctgcctggccaaggtcgcgcccaacgtg
gccaaggaccgcacgtactacatggaggacgtgcaccgcgccggcggcatccccgccctc
ctcggcgaactgcaccgcggcggcctgctcaacgaggacgtccactccgtccacagcccg
tccctggccgactggctgaagacctgggacgtgcgcggcggctccccctccaaggaggca
gtcgagctgtggcacgcggcccccggctgcgtccgctccgccgaggccttctcccagtcc
gagcgctgggacaccctggacgaggacgccgagggcggctgcatccgctccgtcgagcac
gcctactccaaggacggcggcctcgcggtcctgcgcggcaacctcgccgtcgacggctgc
gtcgtcaagacggccggcgtcgacgagtccatctggaccttcgagggcccggcggtcgtc
tgcgagtcgcaggaggaggccgtccagaagatcctcacccagcaggtcaaggagggcgac
gtcgtcgtcatccgctacgagggccccaagggcggccccggcatgcaggagatgctctac
ccgacctcgtacctgaagggccgcggcctcggaaaggcctgcgccctggtcaccgacggc
cgcttctcgggtggcacctcgggcctgtccatcggccacgcctcgccggaggcggcggcc
ggcggcaccatcgccctggtcgaggacggcgaccgcatccgcatcgacatcccgaaccgc
tccatcgagctgctcgtggacgacgccgagctgacccgccgcgagcaggccctgaacggc
gtgtacgccccgaagaaccgcgaccgcaaggtctccgcggccctcaaggcgtacgccgcg
atggccaccagcgccgacaagggcgcggtccgcgacgtcagcaagctgggctga

DBGET integrated database retrieval system