KEGG   Streptomyces coelicolor: SCO3345Help
Entry
SCO3345           CDS       T00085                                 

Gene name
SCE7.12c
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO3345 (SCE7.12c)
   01230 Biosynthesis of amino acids
    SCO3345 (SCE7.12c)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO3345 (SCE7.12c)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO3345 (SCE7.12c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     SCO3345 (SCE7.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3702759..3704612)
Genome map
AA seq 617 aa AA seqDB search
MPELRSRTVTHGRNMAGARALMRASGVPGADIGRKPIIAVANSFTEFVPGHTHLAPVGRI
VSEAVTAAGGIPREFNTIAVDDGIAMGHGGMLYSLPSRDLIADSVEYMVEAHCADALICI
SNCDKITPGMLNAALRLNIPTVFVSGGPMESGRATLVDGTVRTLDLVDAMSEAVNDKISD
ADILRIEENACPTCGSCSGMFTANSMNCLTEAIGLSLPGNGSVLATHTARKTLYENAART
VLDLTRRYYEQDDDSVLPRNIATPAAFGNAMALDIAMGGSTNTILHLLAAAQEAEVSYGL
AEMDALSRSVPCLAKVAPNVAKDRTYYMEDVHRAGGIPALLGELHRGGLLNEDVHSVHSP
SLADWLKTWDVRGGSPSKEAVELWHAAPGCVRSAEAFSQSERWDTLDEDAEGGCIRSVEH
AYSKDGGLAVLRGNLAVDGCVVKTAGVDESIWTFEGPAVVCESQEEAVQKILTQQVKEGD
VVVIRYEGPKGGPGMQEMLYPTSYLKGRGLGKACALVTDGRFSGGTSGLSIGHASPEAAA
GGTIALVEDGDRIRIDIPNRSIELLVDDAELTRREQALNGVYAPKNRDRKVSAALKAYAA
MATSADKGAVRDVSKLG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgaggtcccgcacagtcacccacggccgcaacatggcgggcgcccgcgcc
cttatgcgtgcctccggtgtacccggcgcggacatcgggcggaagccgatcatcgccgtc
gccaacagcttcacggagttcgtgccgggccacacgcacctggcccccgtcggccgcatc
gtcagcgaggcggtcaccgcggccggcggcatcccgcgcgagttcaacacgatcgccgtg
gacgacggcatcgccatgggccacggcggcatgctctacagcctcccctcccgcgacctg
atcgcggacagcgtggagtacatggtcgaggcgcactgcgccgacgccctgatctgcatc
tccaactgcgacaagatcaccccgggcatgctcaacgcggcgctccgcctgaacatcccc
acggtcttcgtctccggcggacccatggagtccggccgcgccaccctggtcgacggcacg
gtccgcaccctcgacctggtcgacgcgatgtcggaggcggtcaacgacaagatctccgac
gcggacatcctccgcatcgaggagaacgcctgcccgacctgcggctcctgttccggcatg
ttcaccgccaactcgatgaactgcctgaccgaggccatcggcctctccctgcccggcaac
ggctcggtcctggccacccacaccgcccgcaagacgctctacgagaacgccgcccgcacg
gtgctcgacctgacccgccgctactacgagcaggacgacgactcggtcctgccgcgcaac
atcgccacccccgccgccttcggcaacgccatggcgctggacatcgcgatgggcggctcc
accaacacgatcctgcacctgctggccgccgcccaggaggccgaggtctcctacggcctc
gccgagatggacgccctctcgcgcagcgtcccctgcctggccaaggtcgcgcccaacgtg
gccaaggaccgcacgtactacatggaggacgtgcaccgcgccggcggcatccccgccctc
ctcggcgaactgcaccgcggcggcctgctcaacgaggacgtccactccgtccacagcccg
tccctggccgactggctgaagacctgggacgtgcgcggcggctccccctccaaggaggca
gtcgagctgtggcacgcggcccccggctgcgtccgctccgccgaggccttctcccagtcc
gagcgctgggacaccctggacgaggacgccgagggcggctgcatccgctccgtcgagcac
gcctactccaaggacggcggcctcgcggtcctgcgcggcaacctcgccgtcgacggctgc
gtcgtcaagacggccggcgtcgacgagtccatctggaccttcgagggcccggcggtcgtc
tgcgagtcgcaggaggaggccgtccagaagatcctcacccagcaggtcaaggagggcgac
gtcgtcgtcatccgctacgagggccccaagggcggccccggcatgcaggagatgctctac
ccgacctcgtacctgaagggccgcggcctcggaaaggcctgcgccctggtcaccgacggc
cgcttctcgggtggcacctcgggcctgtccatcggccacgcctcgccggaggcggcggcc
ggcggcaccatcgccctggtcgaggacggcgaccgcatccgcatcgacatcccgaaccgc
tccatcgagctgctcgtggacgacgccgagctgacccgccgcgagcaggccctgaacggc
gtgtacgccccgaagaaccgcgaccgcaaggtctccgcggccctcaaggcgtacgccgcg
atggccaccagcgccgacaagggcgcggtccgcgacgtcagcaagctgggctga

DBGET integrated database retrieval system