KEGG   Streptomyces coelicolor: SCO3382Help
Entry
SCO3382           CDS       T00085                                 

Gene name
nadB, SCE94.33c
Definition
(RefSeq) L-aspartate oxidase
  KO
K00278  
L-aspartate oxidase [EC:1.4.3.16]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO3382 (nadB)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO3382 (nadB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     SCO3382 (nadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3744824..3746566)
Genome map
AA seq 580 aa AA seqDB search
MTSTGIRLHAPAPGWAIAADVVVVGSGVAGLTAALRCESAGLRTVVVTKARLDDGSTRWA
QGGVAAALGEGDTPEQHLDDTLVAGAGLCDQDAVRILVTEGPDAVRRLIATGAHFDESTE
GGLALTREGGHHRRRIAHAGGDATGAEISRALVEAVRARGLRTVENALVLDLLTDAEGRT
AGVTLHVMGEGQHDGVGAVHAPAVVLATGGMGQVFSATTNPSVSTGDGVALALRAGAEVS
DLEFVQFHPTVLFLGSDAEGQQPLVSEAVRGEGAHLVDADGVRFMQGRHELAELAPRDIV
AKAITRRMQEHGADHMYLDARHFGRTMWEHRFPTILAACRAHGIDPVTEPVPVAPAAHYA
SGGVRTDAHGRTTVPGLYACGEVACTGVHGANRLASNSLLEGLVYAERIAADIAAAHTAG
TLHARVPAPLPHPDHSQHPRHPLLPPEARLTIQRIMTEGAGVLRSADSLARAADRLHGLH
AEAREALHEHGKTSEPGVDTWEATNLLCVARVLVAAAARREETRGCHWREDHADRDDTTW
RRHVVVRLNPDRTLAVHTTDTPEFPPTVHGAQPTHRPQEQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcacaggcatacgactgcacgcccccgcgcccggctgggccatcgccgcggac
gtggtggtcgtcggctccggcgtcgcgggcctcaccgcggccctgcgctgcgagtccgcc
ggtctgcggaccgtcgtcgtcaccaaggcccgcctggacgacggctccacccgctgggcc
cagggcggcgtcgccgcggccctcggcgagggcgacacccccgagcagcacctggacgac
accctggtcgccggcgccggcctgtgcgaccaggatgcggtccgcatcctggtcaccgag
ggccccgacgccgtacgccggctcatcgcgaccggcgcgcacttcgacgagtccaccgag
ggcggcctggccctcacccgggagggcggccaccaccgccgccgcatcgcccacgcgggc
ggcgacgccacgggcgccgagatctcccgcgccctggtcgaggcggtacgcgcgcgaggg
ctgcgcacggtggagaacgccctcgtcctggacctcctcacggacgccgagggccgtacc
gcgggcgtcaccctgcacgtcatgggcgagggccagcacgacggtgtcggggcggtccac
gcccccgcggtcgtcctcgccaccggcggcatgggccaggtcttctcggcgacgacgaac
ccctccgtctccacgggcgacggagtggccctcgccctgcgcgccggcgccgaggtgagc
gatctcgagttcgtccagttccaccccaccgtcctcttcctgggctcggacgccgagggc
cagcagcccctggtctccgaggcggtacgcggcgagggcgcccacctggtcgacgcggac
ggcgtgcgcttcatgcagggccggcacgaactggcggaactggccccgcgggacatcgtc
gcgaaggccatcacgcgccgcatgcaggagcacggcgccgaccacatgtacctggacgcc
cgccacttcggcaggacgatgtgggagcaccgcttccccacgatcctggccgcctgccgc
gcccacggcatcgacccggtcaccgaaccggtcccggtcgccccggccgcccactacgcc
tcgggcggcgtccgcaccgacgcccacggccgtacgacggtccccggcctgtacgcctgc
ggagaggtcgcctgcacgggcgtgcacggcgccaaccgcctggcctccaactccctcctc
gagggcctggtctacgccgaacgcatcgcggccgacatagcggccgcccacacggccggc
accctgcacgcgcgcgtaccggcccccctcccgcacccggaccactcgcaacacccgcga
caccccctcctccctcccgaggcgcgcctcaccatccagcggatcatgacggagggcgcc
ggggtcctgcgctcggcggactccctcgcgcgcgcggccgaccggctgcacggcctccac
gccgaggcccgcgaggccctgcacgagcacggcaagacctccgaacccggtgtcgacacc
tgggaggccaccaacctcctgtgcgtggcccgcgtcctggtcgccgcggcggcacggcgc
gaggagacccgcggctgccactggcgcgaggaccacgcggaccgcgacgacaccacgtgg
cgccgccacgtcgtcgtacggctgaaccccgatcgcacgctcgccgtgcacaccacggac
acgccagaattccccccgaccgtccacggcgcccagccgacgcaccgtccccaggagcag
tga

DBGET integrated database retrieval system