KEGG   Streptomyces coelicolor: SCO3400Help
Entry
SCO3400           CDS       T00085                                 

Gene name
folB, SCE9.07
Definition
(RefSeq) dihydroneopterin aldolase
  KO
K01633  
dihydroneopterin aldolase / 7,8-dihydroneopterin epimerase [EC:4.1.2.25 5.1.99.8]
Organism
sco  Streptomyces coelicolor
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCO3400 (folB)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     SCO3400 (folB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     SCO3400 (folB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3765814..3766173
Genome map
AA seq 119 aa AA seqDB search
MDRVALRGLKARGHHGVFPKEREDGQTFLVDIVLGLDTRPAAADDDLAKTVHYGIVAEEV
VAVVEGEPVNLVETLAERIAQVCLKHEGVEEVEVCVHKPDAPITVPFDDVTVTIIRSRV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgtgtcgcgctgcgcggcctgaaggcccgcgggcaccacggtgtgttccccaag
gagcgcgaggacggccagaccttcctcgtggacatcgtccttggcctggacacccgcccg
gccgcggccgacgacgacctggcgaagacagtgcactacggcatcgtggccgaggaggtc
gtggccgtcgtcgagggcgagccggtcaacctcgtcgagaccctcgccgagcgcatcgcc
caggtctgtctgaagcacgaaggggtcgaggaggtcgaggtctgcgtccacaagccggac
gcgccgatcaccgtccccttcgacgacgtgaccgtcaccatcatccggagccgtgtatga

DBGET integrated database retrieval system