KEGG   Streptomyces coelicolor: SCO3405Help
Entry
SCO3405           CDS       T00085                                 

Gene name
hprT, SCE9.12c
Definition
(RefSeq) hypoxanthine phosphoribosyltransferase
  KO
K00760  
hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO3405 (hprT)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     SCO3405 (hprT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3770329..3770892)
Genome map
AA seq 187 aa AA seqDB search
MMRVDANDMGADLEKVLITKEEIDAKLAELAAKIDAEYAGKDLLIVGVLKGAVMVMADLA
RTLSTPVTMDWMAVSSYGAGTQSSGVVRILKDLDTDIKGRHVLIVEDIIDSGLTLSWLIS
NLGSREPASLKVCTLLRKPDAAKVAIDVEWVGFDIPNEFVVGYGLDYAEKYRNLPFVGTL
APHVYGG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgggtggacgcgaacgacatgggtgccgacctcgagaaggtactcatcaccaag
gaagagatcgacgcgaagctggccgagctggccgcgaagatcgacgcggagtacgcgggc
aaggacctgctcatcgtcggcgtcctcaagggcgccgtgatggtcatggccgacctggcg
cgcacgctgtccacccccgtcacgatggactggatggcggtgtcctcgtacggcgcgggc
acccagtcctccggtgtggtgcggatcctcaaggacctcgacaccgacatcaagggccgc
cacgtcctgatcgtcgaggacatcatcgactccggcctgaccctgtcctggctgatctcc
aacctcggctcgcgcgagcccgcctccctcaaggtgtgcacgctgctgcgcaagcccgac
gccgcgaaggtcgccatcgacgtggagtgggtcggcttcgacatccccaacgagttcgtc
gtcggctacggcctcgactacgccgagaagtaccgcaacctcccgttcgtcggtacgctc
gcgccccacgtgtacggcggctga

DBGET integrated database retrieval system