KEGG   Streptomyces coelicolor: SCO3416Help
Entry
SCO3416           CDS       T00085                                 

Gene name
gad, SCE9.23
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO3416 (gad)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO3416 (gad)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO3416 (gad)
   00430 Taurine and hypotaurine metabolism
    SCO3416 (gad)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO3416 (gad)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SCO3416 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3781328..3782755
Genome map
AA seq 475 aa AA seqDB search
MSLHQGPRPSRDSDRDRRRLAVNPFHAAANPLGGMTEAPPAHRLPDSPLPPESAYRLVHD
ELMLDGNARLNLATFVTTWMEPQAGVLMSECRDKNMIDKDEYPRTAELERRCVAMLADLW
HAPDPSTAVGCSTTGSSEACMLAGMALKRRWALRNADRYPAKDVRPNLVMGVNVQVCWDK
FCNFWEVEARQVPMEGDRFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVADLCAALD
ALQERTGLDVPVHVDGASGAMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWAL
WRDAEALPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYNFLRLGREGYRAVQQSARD
IAGSLAERVAALGDFRLLTRGDQLPVFAFTTADDVTAYDVFDVSRRLREGGWLVPAYTFP
PHREDLSVLRVVCRNGFSADMADLLLADLERLLPELRRQPGPLTRDKGAATGFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaccagggcccgcgcccgtcccgcgacagcgatcgtgaccggcgccggctc
gccgtgaaccccttccacgcggcggcgaacccgctcggcggcatgaccgaggccccgccc
gcccaccggctgcccgactccccgctgccaccggagagcgcgtaccgcctggtccacgac
gagctgatgctggacggcaacgcgcggctgaacctggccaccttcgtcaccacctggatg
gagccgcaggccggggtgctgatgagtgagtgccgtgacaagaacatgatcgacaaggac
gagtacccgcgcaccgccgaactggagcggcgttgcgtggccatgctcgccgacctgtgg
cacgcgcccgacccgtcgaccgcggtgggctgctcgacgaccgggtcgagcgaggcgtgc
atgctggccgggatggcgctgaagcggcgctgggcactgcgcaacgccgaccggtacccg
gcgaaggacgtgcggcccaatctggtgatgggcgtcaacgtccaggtctgctgggacaag
ttctgcaacttctgggaggtggaggcccggcaggtcccgatggagggcgaccgcttccac
ctggacccgcaggccgccgccgagctgtgcgacgagaacacgatcggggtcgtcggcatc
ctgggctccaccttcgacggctcctacgaaccggtcgccgacctgtgcgcggccctggac
gccctccaggagcggaccggactcgacgtcccggtgcacgtcgacggggcctcgggcgcc
atggtcgcgcccttcctggacgaggacctggtgtgggacttccggctgcccagggtcgcc
tcgatcaacacctcggggcacaagtacgggctggtctaccccggggtcggctgggcgctg
tggcgggacgcggaggcccttcccgaggaactggtcttccgggtcaactacctgggcggc
gacatgccgaccttcgcgctgaacttctcccggccgggcgcgcaggtcgtcgcgcagtac
tacaacttcctgcggcttggccgtgagggctaccgggccgtgcagcagtccgcgcgggac
atcgcgggctcgctcgcggaacgggtggcggcactcggcgacttccggctgctgacgcgc
ggcgaccagttgcccgtgttcgccttcacgacggccgacgacgtgacggcgtacgacgtc
ttcgacgtgtcccggcggctgcgggagggcggctggctggtgccggcgtacaccttcccg
ccgcaccgcgaggacctctccgtgctgcgggtggtgtgccgcaacggcttctcggccgac
atggccgacctgctgctcgcggacctggagcgcctgctcccggaactgcggcgccagccg
ggcccgctgacccgcgacaagggggcggcgacggggttccatcactga

DBGET integrated database retrieval system