KEGG   Streptomyces coelicolor: SCO3474Help
Entry
SCO3474           CDS       T00085                                 

Gene name
SCE65.10c
Definition
(RefSeq) sugar kinase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3834741..3835742)
Genome map
AA seq 333 aa AA seqDB search
MTRPVVEGGPAVVCLGETMAQIVPIDGLRLHEASACAFGVAGAESNVAISLSRLGTAAFW
AGFVGDDPMGLRVLGELRRHGVVTKLARTMPGRRTGVYFKDPAPEGSDIYYYRSGSAATL
MDGEYAERIAAVRPRWIHLTGVTPALSENCREAVISLIELAGDTGASVSFDVNYRPSLWP
ARDAAAQSLMAIADRCNVVFVGLDEAQTLWKSCTAGAVRDHLPSPDVVVVKDGGREAVAF
RGGRRTAVPALPVDVVEPVGAGDAFAAGWIHGALVGLDEAGCLRLGHLLAGAAMTSLSDV
ADLPTAPAALVARAKHGNEWPGHGSPAEASPHP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacccggcctgtggtggaaggagggcctgccgtcgtctgtctgggcgagacgatggcg
cagatcgtgccgatcgacggccttcgtcttcacgaggcgtccgcctgtgccttcggggtg
gcgggcgccgagtcgaacgtcgcgatctccctctcgaggctgggcacagccgcgttctgg
gccggattcgtcggagacgacccgatgggtctccgtgtccttggcgaactccgtcggcac
ggcgtggtgacgaagctcgcgcgtacgatgccgggacgcagaacgggcgtctacttcaag
gaccccgcgcccgaagggtccgacatctactactaccggtccggctcggccgccacgctc
atggacggagagtacgcggaacggatcgctgcggtgcgtccccgctggatccacctgacc
ggtgtgacgccggcattgtcggagaactgtcgtgaagcggtcatctcgctgatcgagctc
gcgggtgatacgggagcgagtgtcagtttcgacgtcaactaccgcccgtccctctggcca
gcccgcgacgctgcggcacagtcgctcatggccatcgccgatcgttgcaatgtggttttc
gtcggcctcgacgaggcgcagaccctgtggaaatcttgcaccgcgggagcggtccgggac
catctcccgagtccggacgtcgtcgtagtgaaggacggcggcagagaggccgtcgccttc
cgcggaggccgtcggaccgcggtgcccgcgctgcccgtcgacgtggtcgaacccgtcggt
gccggtgacgcgttcgccgcaggatggattcacggagccctcgtgggccttgacgaggcc
ggttgcctgcgactcgggcacctgctggccggtgccgcgatgacatcgctctcggacgtt
gccgacctgcctaccgccccggcagcgctggtagcacgggcgaagcacggcaacgaatgg
cccggacacggttcccctgccgaggcgagcccacacccctga

DBGET integrated database retrieval system