KEGG   Streptomyces coelicolor: SCO3494Help
Entry
SCO3494           CDS       T00085                                 

Gene name
SCE65.30c
Definition
(RefSeq) sugar kinase
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO3494 (SCE65.30c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     SCO3494 (SCE65.30c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 1098930
NCBI-ProteinID: NP_627695
Kitasato: SCO3494
UniProt: Q9RKE4
Position
complement(3859063..3860043)
Genome map
AA seq 326 aa AA seqDB search
MTDSRAGLGPQAAGGLLTFGETMGLVTATTIGTLEYARDFTFGIGGAESNVAIGAARLGA
PVTWIGRVGSDAAGDLVGRRMRAEGIQTVAVRDTSFTGLMVRHHRAATVVHVDYHRAGSA
GSRLTAHDIPVGEIRRAAILHLTGITPALSASARQATWDAVAAAKANGVRVSLDVNHRSK
LWDRDTARRELRRLVAEADIVFAGIEEAQLVLDSEADAPESLADALAATGPGETVVKTGA
RGCTAHIDGAIHEEPALSVPVVDTVGAGDAFVAGYLAEHLRGAGPVQRLRTACAMGAYAV
SVPGDCELLPTRSELETFLTTGDVLR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacagactcccgtgccggactcggaccacaggccgcaggcggtctgctcaccttcggc
gagaccatggggctggtcaccgcgaccacgatcggcaccctggagtacgcacgtgacttc
accttcggtatcggcggcgccgagagcaacgtggccatcggtgccgcgcgcctcggggcc
ccggtcacctggatcggccgcgtgggaagcgacgcggccggagatctcgtcggacgccgc
atgagggccgaaggcatccagaccgtggcggtccgggacacctccttcaccggcctcatg
gtccgccaccaccgcgccgccaccgtggtccatgtcgactaccaccgcgccggatcggcc
ggctcccgcctcaccgcgcacgacatcccggtcggggagatccggcgggccgcgatcctc
catctcaccggtatcaccccggccctcagcgcctccgcccgccaagccacctgggacgcg
gtcgccgcggcgaaggcgaacggcgtacgcgtcagcctcgacgtgaaccaccgcagcaag
ctctgggaccgagacaccgcccggcgagagctgcgacggctcgtcgcggaggcggacatc
gtcttcgccgggatcgaggaagcccaactcgtcctcgattcagaggcggacgctcctgaa
tccctggccgatgccctggcagcgacggggccgggggagaccgtcgtgaagaccggcgcc
cggggatgcaccgcgcacatcgacggcgcgatccacgaggaacctgcgctgtccgttccc
gtcgtcgacaccgtcggggccggcgacgcgttcgtggccggatacctggcagaacatttg
cgaggagccggccccgtccaacggctccggacggcctgcgccatgggcgcctacgctgtg
tccgtccccggcgactgcgaactgctcccgacccgcagtgagctggagaccttcctgacg
accggagacgtcctgcgatga

DBGET integrated database retrieval system