KEGG   Streptomyces coelicolor: SCO3547Help
Entry
SCO3547           CDS       T00085                                 

Gene name
hppA
Definition
(RefSeq) membrane-bound proton-translocating pyrophosphatase
  KO
K15987  
K(+)-stimulated pyrophosphate-energized sodium pump [EC:3.6.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:sco00001]
  Energy metabolism
   00190 Oxidative phosphorylation
    SCO3547 (hppA)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     SCO3547 (hppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3920987..3923371)
Genome map
AA seq 794 aa AA seqDB search
MAELPTSHLAAAVLTDGNRALVAVIAVVALAALVLAGVLVRQVLAAGEGTDSMKKIAAAV
QEGANAYLARQLRTLGVFAVVVFFLLMLLPADDWNQRAGRSIFFLIGAAFSAATGYIGMW
LAVRSNVRVAAAAREATPAPGEPEKDLALVSHKATKIAFRTGGVVGMFTVGLGLLGACCV
VLVYAADAPKVLEGFGLGAALIAMFMRVGGGIFTKAADVGADLVGKVEQGIPEDDPRNAA
TIADNVGDNVGDCAGMAADLFESYAVTLVAALILGKVAFGDFGLAFPLLVPAIGVLTAMI
GIFAVAPRRSDRSGMSAINRGFFISAVISLVLVAVAVFVYLPGKYADLDGVTDAAIAGKS
GDPRILALVAVAIGIVLAALIQQLTGYFTETTRRPVKDIGKSSLTGPATVVLAGISLGLE
SAVYTALLIGLGVYGAFLLGGTSIMLALFAVALAGTGLLTTVGVIVAMDTFGPVSDNAQG
IAEMSGDVEGAGAQVLTDLDAVGNTTKAITKGIAIATAVLAAAALFGSYRDAITTGAADV
GEKLSGEGAPMTLMMDISQPNNLVGLIAGAAVVFLFSGLAINAVSRSAGAVVYEVRRQFR
ERPGIMDYSEKPEYGKVVDICTRDALRELATPGLLAVMAPIFIGFTLGVGALGAFLAGAI
GAGTLMAVFLANSGGSWDNAKKLVEDGHHGGKGSEAHAATVIGDTVGDPFKDTAGPAINP
LLKVMNLVALLIAPAVIKFSYGADKSVVVRVLIAVVAFAVIAAAVYVSKRRGIAMGDEDD
ADPEPKSADPAVVS
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcttcctacctctcatctcgcggctgccgtgctgaccgacggaaaccgcgcg
ctggtcgcggtcatcgcggtcgtcgcgctggcagcgctggtgctcgcgggtgtcctggtg
cgccaggtgctcgcggcgggcgagggaaccgacagcatgaagaagatcgcggcggccgtc
caggaaggtgcgaacgcgtacctggcccggcagttgcgcacgctcggcgtattcgccgtc
gtcgtgttcttcctgctcatgctgctgcccgcggacgactggaatcaacgtgccggacgt
tcgatcttcttcctgatcggcgcggccttctcggcggccaccggctatatcggcatgtgg
ctcgccgtgcgcagcaatgtgcgcgtcgccgcggcggcccgggaagcgacaccggccccc
ggcgaaccggaaaaggatctcgctctcgtctcgcacaaagcgacgaagatcgcgtttcgc
acgggcggcgtcgtcggcatgttcacggtgggcctgggcctgctgggcgcctgctgcgtg
gtgctggtgtacgcggccgacgcgccgaaggtcctggagggcttcggcctcggtgccgcg
ctgatcgcgatgttcatgcgcgtcggcggcggcatcttcaccaaggccgccgacgtcggc
gccgacctggtcggcaaggtcgaacagggcatcccggaggacgatccgcgcaacgccgcg
accatcgccgacaacgtgggcgacaacgtcggcgactgcgcgggcatggcggccgacctc
ttcgagtcgtacgccgtcaccctggtggccgcgctgatcctcggcaaggtggcgttcggc
gacttcgggctggcgttcccgctgctggtcccggcgatcggcgtgctcacggccatgatc
ggcatcttcgcggtggcgccccggcgctccgaccgcagcggcatgagcgcgatcaaccgg
ggcttcttcatctccgcggtgatctcgctggtgctggtggcggtcgccgtcttcgtctac
ctgccgggcaagtacgccgacctcgacggtgtcaccgacgcggcgatcgcgggcaagagc
ggcgacccgcggatcctcgcgctggtcgccgtcgcgatcggcatcgtgctcgccgccctg
atccagcagctcaccggatacttcaccgagaccaccaggcgcccggtcaaggacatcggc
aagtcctcgctcaccgggcccgccaccgtcgtcctcgccgggatctcgctcggtctcgaa
tccgccgtctacaccgccctgttgatcggcctcggcgtctacggggccttcctgctcggc
ggtacgtcgatcatgctggcgctgttcgcggtggcgctggccggcaccggtctgctcacc
acggtcggtgtgatcgtcgccatggacaccttcgggccggtctccgacaacgcgcagggc
atcgccgagatgtccggcgacgtcgagggcgccggcgcccaggtgctcaccgacctggac
gccgtcggcaacaccaccaaggccatcaccaagggcatcgccatcgccaccgccgtactg
gccgccgcggccctcttcgggtcgtaccgcgatgccatcaccaccggcgcggcggacgtg
ggcgagaaactcagcggcgagggcgcgccgatgactttgatgatggacatctcacagccc
aacaacctcgtcgggctcatcgccggtgcggcggtcgtcttcctcttctcggggctggcg
atcaacgcggtgtcgcggtcggcgggcgcggtggtctacgaggtgcggcggcagttccgg
gagcggcccggaatcatggactacagcgagaagcccgagtacggcaaggtcgtcgacatc
tgcaccagggacgccctgcgggagctcgccacgcccggactgctcgccgtgatggcgccc
atcttcatcgggttcacgctcggcgtcggcgcgctcggcgcgttcctggcgggcgcgatc
ggcgccgggacgctgatggcggtgttcctcgccaactccggtggttcctgggacaacgcc
aagaaacttgtcgaggacggccaccacggcggcaagggcagcgaggcccatgccgccacc
gtgatcggcgacacggtcggcgacccgttcaaggacaccgcgggtccggcgatcaacccg
ctgctgaaggtcatgaacctggtggcgctgctcatcgcgccggcggtcatcaagttctcc
tacggagccgacaagagcgtggtcgtgcgggtgctgatcgcggtcgtcgcgttcgccgtc
atcgcggcggccgtctacgtgtccaagcggcgcgggatcgccatgggcgacgaggacgac
gccgacccggaacccaagtcggccgatccggccgtggtttcgtag

DBGET integrated database retrieval system