KEGG   Streptomyces coelicolor: SCO3564Help
Entry
SCO3564           CDS       T00085                                 

Gene name
nhaA
Definition
(RefSeq) pH-dependent sodium/proton antiporter
  KO
K03313  
Na+:H+ antiporter, NhaA family
Organism
sco  Streptomyces coelicolor
Brite
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO3564 (nhaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
3943390..3944814
Genome map
AA seq 474 aa AA seqDB search
MTAPRTPRKAFGRLSLPERTYLADALRTETVGGVLLLVAAIAALVWANIPALHDSYESVS
HFHFGPAALGLNLSVAHWAADGLLAIFFFVAGIELKRELVAGDLKDPKAAALPVVAALCG
MVVPAVVYTVTSTAGGGSLSGWAVPTATDIAFALAVLAVIGTSLPSALRAFLLTLAVVDD
LFAILIIAVFFTETLNFAALGGAVVGLAVFWLLLRKGVRGWYVYVPLGLVIWALMYNSGV
HATIAGVAMGLMLRCHRREGEDHSPGEHIEHLVRPLSAGLAVPLFALFSAGVAITGGALA
DVFTKPETLGVVLGLVVGKTLGIFGGTWLTSRFTRASLSDDLQWADVFAVATLAGIGFTV
SLLIGELAFEDDAAMTSEVKAAVLTGSLIAAALATVLLKIRNAKYRGMVAEEERDDDLSG
VPDIYEEDDPAYHLRVAAIYEKKAAEHRRIAEEMESARLAEVAGGAGDEGDGPA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccccgcaccccccgcaaagccttcggacggctgtccctgccggagcgcacc
tacctcgcggacgcgctgcgcaccgagaccgtcggcggcgtcctgctgctcgtcgccgcg
atcgccgccctggtgtgggcgaacataccggcgctgcacgacagctacgagagcgtcagc
cacttccacttcggtcccgcggccctcggtctgaacctgtcggtcgcacactgggccgcc
gacgggcttctggcgatcttcttcttcgtcgccggcatcgaactcaaacgcgaactggtc
gccggtgatctgaaggaccccaaggccgccgcgctcccggtggtggcggcgctgtgcggc
atggtcgtaccggcggtcgtctacaccgtcaccagcaccgcgggcggcggctccctgtcc
ggctgggccgtgccgaccgccaccgacatcgccttcgcgctcgccgtactcgccgtcatc
ggcacgtcgctgccgagcgcgctgcgcgccttcctgctgacgctcgccgtcgtcgacgac
ctgttcgccatcctgatcatcgcggtcttcttcaccgagaccctgaacttcgccgcgctg
ggcggcgcggtcgtcggcctcgcggtcttctggctgctgctgcgcaagggggtgcgcggc
tggtacgtgtacgtgccgctcggcctggtgatctgggccctcatgtacaacagcggcgtc
cacgccaccatcgccggcgtcgcgatgggcctgatgctgcgctgccaccggcgcgagggc
gaggaccactcccccggcgagcacatcgaacacctggtgcgcccgctgtcggcgggcctg
gccgtgccgctgttcgcgctgttcagcgcgggtgtggccatcaccggcggggcgctggcc
gacgtgttcaccaagccggagaccctcggtgtcgtactcgggctcgtcgtcggcaagacg
ctgggcatcttcggcggcacctggctgacctcgcgcttcaccagggcttcgctcagcgac
gacctccagtgggccgacgtgttcgcggtggcgaccctggccggcatcgggttcaccgtc
tcgctgctgatcggcgagctggccttcgaggacgacgcggcgatgacgagcgaggtcaag
gccgccgtcctgaccggctcgctgatcgcggcggccctggccacggtgctgctgaagata
cggaacgcgaagtaccgggggatggtcgcggaggaggagcgcgacgacgacctcagcggt
gtccccgacatctacgaggaggacgaccccgcgtaccacctgcgggtggccgccatctac
gagaagaaggccgccgagcaccgccggatcgccgaggagatggagtcggcgcggcttgcc
gaagtggcgggcggggcaggcgatgagggcgacggtccggcatga

DBGET integrated database retrieval system