KEGG   Streptomyces coelicolor: SCO3614Help
Entry
SCO3614           CDS       T00085                                 

Gene name
asd2, SC66T3.25c
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO3614 (asd2)
   01230 Biosynthesis of amino acids
    SCO3614 (asd2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3614 (asd2)
   00270 Cysteine and methionine metabolism
    SCO3614 (asd2)
   00300 Lysine biosynthesis
    SCO3614 (asd2)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO3614 (asd2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SCO3614 (asd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3993330..3994418)
Genome map
AA seq 362 aa AA seqDB search
MSARQDTGRDGGRTGRPTLAVVGATGAVGSVMLQILSQHADVWGDIRLIASPRSAGRKLA
VRGEEVEVVALSEEAFDGVDVAMFDVPDEVAAQWAPLAAAKGAVVVDNSGAFRMDPDVPL
VVPEVNPHAVRMRPRGIVANPNCTTLSMIVALGALHAEFGLRELVVSSYQAVSGAGRDGV
DTLRRQLSLVAGTELGTHPGDVRRAVGDDTGPFPEPVALNVVPWAGSLREDGWSSEEMKV
RDESRKILGLPNLPVAVTCVRVPVVTTHSLTVHARFEGEVSVQGAREILATAPGVVLFDN
PAAGEFPTPADAVGTDPTWVGRVRRALDDPTALELFVCGDNLRKGAALNTAQIAELVAAE
FG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaggcaagacaccggccgggacggcggccgtaccggccggcccacgctcgcc
gtcgtgggcgcgaccggtgccgtcggctcggtcatgctccagatcctgtcccagcacgcg
gacgtctggggcgacatccgcctgatcgcctccccgcgctcggccggccgcaagctggcc
gtgcggggggaggaggtcgaggtcgtcgcgctgagcgaagaggccttcgacggggtcgac
gtcgccatgttcgacgtgcccgacgaggtcgccgcccagtgggcgccgctcgccgccgcc
aagggcgcggtggtcgtcgacaactccggcgccttccggatggacccggacgtgccgctg
gtcgtgcccgaggtcaatccgcacgcggtgcggatgcggccgcgcgggatcgtcgccaac
ccgaactgcacgacgctgtccatgatcgtggcgctgggcgcgctgcacgccgagttcggg
ttgcgcgagctggtcgtctcctcgtaccaggcggtcagcggggccgggcgggacggcgtg
gacacgctgcgccggcagctgtcgctggtggccggcaccgagctggggacgcaccccggt
gacgtgcggcgggccgtcggcgacgacaccgggccgttcccggagccggtcgcgctgaac
gtcgtaccgtgggccggatcgctgcgggaggacggctggtcgtcggaggagatgaaggtg
cgggacgagtcccgcaagatcctcgggctgccgaacctcccggtcgcggtgacatgcgta
cgggtgcccgtcgtcaccacgcactccctgaccgtgcacgcccgcttcgagggcgaggtc
agtgtccagggggcccgggagatcctggccaccgctcccggcgtcgtcctgttcgacaac
ccggccgcgggggagttcccgacgcccgccgacgcggtcggcaccgacccgacctgggtc
ggccgggtgcgccgggccctggacgacccgaccgcgctcgaactcttcgtctgcggggac
aatctgcgcaagggcgccgcgctcaacaccgcgcagatcgcggagttggtggcggccgag
ttcggctga

DBGET integrated database retrieval system