KEGG   Streptomyces coelicolor: SCO3615Help
Entry
SCO3615           CDS       T00085                                 

Gene name
ask, SC66T3.26c
Definition
(RefSeq) aspartate kinase
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO3615 (ask)
   01230 Biosynthesis of amino acids
    SCO3615 (ask)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3615 (ask)
   00270 Cysteine and methionine metabolism
    SCO3615 (ask)
   00300 Lysine biosynthesis
    SCO3615 (ask)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO3615 (ask)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     SCO3615 (ask)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(3994418..3995695)
Genome map
AA seq 425 aa AA seqDB search
MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGNQVVAVVSAMGDTTDELIDLAEQVSPI
PAGRELDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTSVDEGNVAIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALDADVCEIYTDVDGVF
TADPRVVPKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
VSSEPIKQGEKHVEQALISGVAHDTSEAKVTVVGVPDKPGEAAAIFRAIADAQVNIDMVV
QNVSAASTGLTDISFTLPKSEGRKAIDALEKNRPGIGFDSLRYDDQIGKISLVGAGMKSN
PGVTADFFTALSDAGVNIELISTSEIRISVVTRKDDVNEAVRAVHTAFGLDSDSDEAVVY
GGTGR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgggccttgtcgtgcagaagtacggaggctcctccgtagccgatgccgagggcatcaag
cgcgtcgccaagcggatcgtggaagcgaagaagaacggcaaccaggtggtcgccgtcgtt
tccgcgatgggcgacacgacggacgagctgatcgatctcgccgagcaggtttccccgatc
cctgccgggcgtgaactcgacatgctgctgaccgccggggagcgtatctccatggcgctg
ctggccatggcgatcaaaaacctgggccacgaggcccagtcgttcaccggcagccaggcc
ggagtcatcaccgactcggtccacaacaaggcccggatcatcgacgtcacaccgggtcgc
atccgcacctcggtcgacgagggcaacgtggccatcgtggccggcttccagggcgtcagc
caggacagcaaggacatcaccacgctgggccgcggcgggtccgacaccacggccgtcgcc
ctcgccgccgcgctcgacgcggacgtctgcgagatctacaccgacgtcgacggcgtgttc
accgccgacccgcgcgtggtgccgaaggcgaagaagatcgactggatctccttcgaggac
atgctggagctcgctgcctccggctccaaggtgctgctccaccgttgcgtggagtacgcc
cgccggtacaacatcccgattcacgtgcggtccagcttcagcggactccagggcacgtgg
gtcagcagcgagccgatcaagcaaggggaaaagcacgtggagcaggccctcatctccgga
gtcgcgcacgacacctccgaggccaaggtcacggtcgtcggggtgcccgacaagccgggc
gaggcggccgcgatcttccgcgccatcgccgacgcccaggtcaacatcgacatggtcgtg
cagaacgtgtccgccgcctccacgggcctgacggacatctcgttcacgctccccaagagc
gagggccgcaaggccatcgacgcgctggagaagaaccgcccgggcatcggcttcgactcg
ctgcgctacgacgaccagatcggcaagatctcgctggtcggcgccggtatgaagagcaat
ccgggcgtcaccgccgacttcttcaccgcgctctccgacgccggggtgaacatcgagctg
atctcgacctccgagatccgcatctcggtcgtcacccgcaaggacgacgtgaacgaggcc
gtgcgcgccgtgcacaccgccttcgggctcgactccgacagtgacgaggccgtggtctac
gggggcaccgggcgctga

DBGET integrated database retrieval system