KEGG   Streptomyces coelicolor: SCO3615Help
Entry
SCO3615           CDS       T00085                                 

Gene name
ask, SC66T3.26c
Definition
(RefSeq) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00261  Monobactam biosynthesis
sco00270  Cysteine and methionine metabolism
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
sco_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3615 (ask)
   00270 Cysteine and methionine metabolism
    SCO3615 (ask)
   00300 Lysine biosynthesis
    SCO3615 (ask)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO3615 (ask)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     SCO3615 (ask)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7
Motif
Other DBs
NCBI-GeneID: 1099051
NCBI-ProteinID: NP_627810
Kitasato: SCO3615
UniProt: Q9XAI7
Position
complement(3994418..3995695)
Genome map
AA seq 425 aa AA seqDB search
MGLVVQKYGGSSVADAEGIKRVAKRIVEAKKNGNQVVAVVSAMGDTTDELIDLAEQVSPI
PAGRELDMLLTAGERISMALLAMAIKNLGHEAQSFTGSQAGVITDSVHNKARIIDVTPGR
IRTSVDEGNVAIVAGFQGVSQDSKDITTLGRGGSDTTAVALAAALDADVCEIYTDVDGVF
TADPRVVPKAKKIDWISFEDMLELAASGSKVLLHRCVEYARRYNIPIHVRSSFSGLQGTW
VSSEPIKQGEKHVEQALISGVAHDTSEAKVTVVGVPDKPGEAAAIFRAIADAQVNIDMVV
QNVSAASTGLTDISFTLPKSEGRKAIDALEKNRPGIGFDSLRYDDQIGKISLVGAGMKSN
PGVTADFFTALSDAGVNIELISTSEIRISVVTRKDDVNEAVRAVHTAFGLDSDSDEAVVY
GGTGR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgggccttgtcgtgcagaagtacggaggctcctccgtagccgatgccgagggcatcaag
cgcgtcgccaagcggatcgtggaagcgaagaagaacggcaaccaggtggtcgccgtcgtt
tccgcgatgggcgacacgacggacgagctgatcgatctcgccgagcaggtttccccgatc
cctgccgggcgtgaactcgacatgctgctgaccgccggggagcgtatctccatggcgctg
ctggccatggcgatcaaaaacctgggccacgaggcccagtcgttcaccggcagccaggcc
ggagtcatcaccgactcggtccacaacaaggcccggatcatcgacgtcacaccgggtcgc
atccgcacctcggtcgacgagggcaacgtggccatcgtggccggcttccagggcgtcagc
caggacagcaaggacatcaccacgctgggccgcggcgggtccgacaccacggccgtcgcc
ctcgccgccgcgctcgacgcggacgtctgcgagatctacaccgacgtcgacggcgtgttc
accgccgacccgcgcgtggtgccgaaggcgaagaagatcgactggatctccttcgaggac
atgctggagctcgctgcctccggctccaaggtgctgctccaccgttgcgtggagtacgcc
cgccggtacaacatcccgattcacgtgcggtccagcttcagcggactccagggcacgtgg
gtcagcagcgagccgatcaagcaaggggaaaagcacgtggagcaggccctcatctccgga
gtcgcgcacgacacctccgaggccaaggtcacggtcgtcggggtgcccgacaagccgggc
gaggcggccgcgatcttccgcgccatcgccgacgcccaggtcaacatcgacatggtcgtg
cagaacgtgtccgccgcctccacgggcctgacggacatctcgttcacgctccccaagagc
gagggccgcaaggccatcgacgcgctggagaagaaccgcccgggcatcggcttcgactcg
ctgcgctacgacgaccagatcggcaagatctcgctggtcggcgccggtatgaagagcaat
ccgggcgtcaccgccgacttcttcaccgcgctctccgacgccggggtgaacatcgagctg
atctcgacctccgagatccgcatctcggtcgtcacccgcaaggacgacgtgaacgaggcc
gtgcgcgccgtgcacaccgccttcgggctcgactccgacagtgacgaggccgtggtctac
gggggcaccgggcgctga

DBGET integrated database retrieval system