KEGG   Streptomyces coelicolor: SCO3629Help
Entry
SCO3629           CDS       T00085                                 

Gene name
purA, SCH10.07c
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  
adenylosuccinate synthase [EC:6.3.4.4]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO3629 (purA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO3629 (purA)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SCO3629 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4006900..4008183)
Genome map
AA seq 427 aa AA seqDB search
MPALVLLGAQWGDEGKGKATDLLGGSVDYVVRYQGGNNAGHTVVVGDQKYALHLLPSGIL
SPGCTPVIGNGVVVDPSVLFSELSGLNERGVDTSKLLISGNAHIITPYNVTVDKVTERFL
GKRKIGTTGRGIGPTYADKINRVGIRVQDLYDESILTQKVEAALDVKNQMLTKLYNRRAI
ATGQVVEELLGYADKLAPYVADTVLVLNQALDDDKVVLFEGGQGTLLDIDHGTYPFVTSS
NPTAGGACTGAGVGPTKISRVIGILKAYTTRVGAGPFPTELFDEDGEALRRIGGERGVTT
GRDRRCGWFDAVIARYATRVNGLTDFFLTKLDVLTGWEQIPVCVAYEIDGKRVEELPYSQ
SDFHHAKPVYETLPGWSEDITKAKSFSDLPKNAQAYVKALEEMSGAPISAIGVGPGRDET
IEINSFL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcacttgtgctgctcggtgctcagtggggtgacgaaggcaagggaaaggcgacg
gacctgctcggtggctccgtcgactatgtggtgcgctaccagggcggcaacaacgccggc
cacacggtagtcgtgggcgaccagaagtacgccctgcacctgctcccttccgggattctc
tcccccggctgcacgccggtcatcggaaacggcgtcgtcgtcgacccgtcggtcctgttc
tccgagctgagcgggctgaacgagcgcggcgtcgacacgtccaagctcctgatcagcggc
aacgctcacatcatcacgccgtacaacgtcaccgtcgacaaggtgacggaacgcttcctc
ggcaagcgcaagatcggcaccaccgggcgcggcatcggcccgacctacgccgacaagatc
aaccgcgtgggcatccgggtgcaggacctctacgacgagtcgatcctcacccagaaggtc
gaggcggcgctcgacgtcaagaaccagatgctcaccaagctctacaaccgccgcgccatc
gccaccggccaggtcgtcgaggagctgctgggctacgccgacaagctcgccccgtacgtc
gccgacaccgtcctggtcctcaaccaggccctcgacgacgacaaggtggtcctcttcgag
ggcggccagggcaccctcctggacatcgaccacggcacgtaccccttcgtcacctcgtcg
aacccgaccgcgggtggcgcctgcaccggcgccggcgtgggcccgacgaagatcagccgg
gtcatcggcatcctcaaggcgtacacgacccgcgtcggtgccggaccgttcccgaccgag
ctgttcgacgaggacggcgaggccctgcgccgcatcggcggcgagcgcggcgtcaccacc
ggccgcgaccggcgctgcggctggttcgacgcggtgatcgcccgctacgccacccgcgtc
aacggcctcaccgacttcttcctcaccaagctcgacgtcctcaccggctgggagcagatc
ccggtctgcgtggcctacgagatcgacggcaagcgcgtcgaggagctgccgtactcgcag
tccgacttccaccacgcgaagccggtctacgagacgctgcccggctggagcgaggacatc
accaaggcgaagtccttctccgacctgccgaagaacgcccaggcgtacgtcaaggccctg
gaggagatgtccggcgccccgatctccgcgatcggcgtcggcccgggccgggacgagacg
atcgagatcaactcgttcctgtag

DBGET integrated database retrieval system