KEGG   Streptomyces coelicolor: SCO3649Help
Entry
SCO3649           CDS       T00085                                 

Gene name
fba, SCH10.27c
Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO3649 (fba)
   01230 Biosynthesis of amino acids
    SCO3649 (fba)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO3649 (fba)
   00030 Pentose phosphate pathway
    SCO3649 (fba)
   00051 Fructose and mannose metabolism
    SCO3649 (fba)
  Energy metabolism
   00680 Methane metabolism
    SCO3649 (fba)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SCO3649 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(4027742..4028773)
Genome map
AA seq 343 aa AA seqDB search
MPIATPEVYNEMLDRAKAGKFAYPAINVTSSQTLHAALRGFAEAESDGIVQISTGGAEFL
GGQHNKDMVTGAVALAEFAHIVAEKYDVTVALHTDHCPKDKLDGYVRPLIAVSEERVKAG
RNPLFQSHMWDGSAETLADNLSIAQELLARARAARIILEVEITPTGGEEDGVSHEINDSL
YTTVDDAVRTVEALGLGEKGRYLLAASFGNVHGVYKPGNVVLRPELLKELNEGIASKYGQ
PAGSKPFDFVFHGGSGSTAEEIATALENGVVKMNIDTDTQYAFTRPVVDHMFRNYDGVLK
VDGEVGNKKTYDPRTWGKLAEAGMAARVVEACGHLRSAGQKIK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgcaactcccgaggtctacaacgagatgctggaccgggcgaaggcaggaaag
ttcgcctaccccgccatcaacgtgacctcttcccagacgctgcacgccgccctgcgcggc
ttcgcggaggcggagagcgacggcatcgtccagatctccaccggcggcgccgagttcctg
ggcggccagcacaacaaggacatggtgaccggcgccgtcgccctcgccgagttcgcgcac
atcgtcgccgagaagtacgacgtcaccgtcgccctgcacacggaccactgccccaaggac
aagctcgacgggtacgtacgcccgctgatcgccgtctccgaggagcgcgtcaaggccggc
cgcaacccgctgttccagtcgcacatgtgggacggctcggccgagaccctggccgacaac
ctctccatcgcccaggagctgctggcgcgcgcccgcgccgccaggatcatcctcgaggtc
gagatcaccccgaccggcggcgaggaggacggcgtctcccacgagatcaacgactccctg
tacaccacggtcgacgacgcggtccgcaccgtcgaggccctgggcctgggcgagaagggc
cgctacctgctcgccgcgtccttcggcaacgtgcacggcgtctacaagccgggcaacgtc
gtgctccgccccgagctgctcaaggagctgaacgagggcatcgcgtcgaagtacggccag
ccggccggcagcaagccgttcgacttcgtcttccacggcggctccggctccaccgccgag
gagatcgcgaccgccctggagaacggcgtggtcaagatgaacatcgacacggacacccag
tacgccttcacgcgtccggtcgtcgaccacatgttccgcaactacgacggcgtcctcaag
gtcgacggcgaggtcggcaacaagaagacgtacgacccgcgcacctggggcaagctggcc
gaggccggcatggccgcgcgcgtcgtggaggcctgcggccacctgcgctcggcgggccag
aagatcaagtaa

DBGET integrated database retrieval system