KEGG   Streptomyces coelicolor: SCO3658Help
Entry
SCO3658           CDS       T00085                                 

Gene name
SCH10.36
Definition
(RefSeq) aminotransferase
  KO
K14267  
N-succinyldiaminopimelate aminotransferase [EC:2.6.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO3658 (SCH10.36)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO3658 (SCH10.36)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.17  succinyldiaminopimelate transaminase
     SCO3658 (SCH10.36)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class I
   SCO3658 (SCH10.36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
4036689..4037879
Genome map
AA seq 396 aa AA seqDB search
MTSMSSSARPLLNRRLAEFGTTIFAEMSALAVRTGAINLGQGFPDTDGPEEVREAAVRAL
RDGRGNQYPPGPGVPELRAAVAGHQQRRYGLSYDPDTEVLVTAGATEAIAAALLALLEPG
DEVVALEPYYDSYAACIAMAGGTRVPVTLRPHEGTFRLDLDELRDAVTDRTRLLLLNTPH
NPTGTVLTRDELAAIAELAVERDLLVVTDEVYEHLVFGTAEHIPLASFPGMRERTVTIGS
AGKTFSFTGWKVGWVTAAPALLTAVRSAKQYLTYVASGPFQYAVAEALALPESYFAAYRQ
DMEAKRDLLAAGLAEAGFGVYRPAGTYFVTTDIRPLGERDGFAFCRSLPERAGVVAVPNA
VFYNHREEGAPFVRFAFCKRLPVLEEAVGRLKTLSA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgatgagctccagcgcccgccccctcctgaaccgccggctcgcggagttcggg
acgacgatcttcgccgagatgtccgccctggcggtgcggaccggggcgatcaacctcggc
cagggcttccccgacaccgacggccccgaggaggtccgggaggccgcggtgcgggcactg
cgcgacgggcgcggcaaccagtaccccccgggcccgggcgtccccgagctgcgcgccgcc
gtcgccggccaccagcagcgccgctacggcctgtcctacgaccccgacaccgaggtcctg
gtcaccgccggcgccacggaggccatcgcggccgccctgctggccctgctggagcccggc
gacgaggtcgtcgcgctggagccgtactacgactcgtacgcggcctgcatcgcgatggcg
ggcggcacccgcgtgccggtgaccctgcggccgcacgagggcacgttccgtctggacctg
gacgagctgcgcgacgcggtcaccgaccgcacccgcctgctgctgctgaacaccccgcac
aacccgacgggcacggtcctcacccgcgacgagctggccgcgatcgccgagctggcggtg
gagcgcgacctgctggtggtgaccgacgaggtctacgagcacctggtcttcggcaccgcc
gagcacatccccctggcgtccttcccggggatgcgggagcgcacggtgaccatcgggtcg
gccggcaagacgttctcgttcaccggctggaaggtcggctgggtcaccgccgcgcccgcc
ctgctcacggcggtccgctcggccaagcagtacctgacgtacgtggcctcggggcccttc
cagtacgccgtcgccgaggcgctcgcgctgccggagtcgtacttcgccgcctaccggcag
gacatggaggcgaagcgggacctgctggccgcgggcctggccgaggcgggcttcggcgtg
taccgccccgccgggacgtacttcgtcaccaccgacatccgcccgctcggcgagcgcgac
ggcttcgccttctgccgctccctgcccgagcgcgcgggcgtcgtcgccgtccccaacgcg
gtcttctacaaccaccgggaggagggcgcgcccttcgtgcggttcgcgttctgcaagcgg
ctgccggtgctggaggaggcggtggggcggctcaagacgctctcggcgtga

DBGET integrated database retrieval system