KEGG   Streptomyces coelicolor: SCO3678Help
Entry
SCO3678           CDS       T00085                                 

Gene name
dcd
Definition
(RefSeq) deoxycytidine triphosphate deaminase
  KO
K01494  
dCTP deaminase [EC:3.5.4.13]
Organism
sco  Streptomyces coelicolor
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO3678 (dcd)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     SCO3678 (dcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(4061079..4061654)
Genome map
AA seq 191 aa AA seqDB search
MLLSDKDIRAEIDNGRVRIDPFDDSMVQPSSIDVRLDRYFRVFENHRYPHIDPSVEQVDL
TRLVEPEGDEPFILHPGEFVLASTYEVVSLPDDLASRLEGKSSLGRLGLVTHSTAGFIDP
GFSGHVTLELSNLATLPIKLWPGMKIGQLCLFRLTSPAEHPYGSERYGSRYQGQRGPTAS
RSFLNFHRTQV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgcttctctcagacaaggacatccgggccgagatcgacaacgggcgggtgcggatcgat
ccgttcgacgactccatggtgcagccgtcgagcatcgacgtgcgtctcgaccgctacttc
cgggtgttcgagaatcaccggtacccgcacatcgacccctccgtcgagcaggtggatctg
acccggctcgtggagcccgagggcgacgagccgttcatcctgcaccccggcgagttcgtg
ctggccagtacgtacgaggtcgtctcgctgccggacgatctcgcctcgcggctggagggg
aagagttcgctcgggcggctcgggctggtcacgcactccaccgccgggttcatcgacccg
gggttctccgggcacgtgacgctggagctgagcaatctcgcgaccctgccgatcaagctg
tggccggggatgaagatcgggcagctgtgcctgttccggctcacctcgccggccgagcac
ccgtacgggagcgagcgctacgggtcccgctaccagggccagcgggggccgaccgcctcc
cggtccttcctcaatttccatcggacccaggtatga

DBGET integrated database retrieval system