KEGG   Streptomyces coelicolor: SCO3780Help
Entry
SCO3780           CDS       T00085                                 

Gene name
SCH63.27
Definition
(RefSeq) sugar hydrolase
  KO
K01187  
alpha-glucosidase [EC:3.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO3780 (SCH63.27)
   00500 Starch and sucrose metabolism
    SCO3780 (SCH63.27)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SCO3780 (SCH63.27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
4155682..4157352
Genome map
AA seq 556 aa AA seqDB search
MTVRSTASTPDLSSKDPNWWRQAVIYQVYPRSFADADGDGLGDLRGVTQRLTHLAALGVD
ALWLSPFYPSELADGGYDVDDYRDVDPRLGTLDDFDELAAEAHRLGLKVIVDLVPNHTSH
RHAWFREALAAGPGSAARDRYVFRDGRGAHGELPPTDWQSVFGGSAWQRVPDGQWYLHLF
APQQPDLNWENEQVRADFRTTLKFWCDRGVDGFRVDVAHALVKDLTEPLRDLGAPELSGE
AALAQFAPGTHPFYDRDDVHEVYRDWRKILDAYTPPRTAVAEAWVPGPRRVLYARPDELG
QAFNFEYLQTGWDAAELREVITGSLADARAAGASATWVLSNHDVVRHATRLVLPPDTDTD
AWLLSGGRAPAVDPAAGLRRARAATLLMLALPGSAYLYQGEELGLPEVAGLPTEVLQDPI
WEQTGHVRKGRDGCRVPLPWTTEGPSYGFGAGGAWLPQPPDFAAYAVQAQDGVAGSTLEL
YRTALRLRRKLLAGESLTWSDDVPAGVLRFDRSDGWRCVTNLSGTAVDLPAGEVLLSSAP
LEDGRLGPDTTVWLGL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtacgcagcaccgccagcacccccgacctgtcgtccaaggatcccaactggtgg
cggcaggccgtcatctaccaggtctatccccgcagcttcgccgacgccgacggcgacggg
ctcggcgacctgcgcggcgtcacccagcgcctgacccacctggccgccctcggcgtcgac
gccctgtggctcagccccttctacccctccgaactcgccgacggcggctacgacgtcgac
gactaccgcgacgtcgacccgcgcctgggcacgctggacgacttcgacgagctggccgcc
gaggcccaccggctgggcctgaaggtgatcgtcgacctggtgcccaaccacacctcgcac
cgccacgcctggttccgggaggcgctggccgccggtcccgggtcggccgcccgcgaccgg
tacgtcttccgcgacggccgcggcgcgcacggcgaactcccgcccaccgactggcagtcc
gtcttcggcggcagcgcctggcagcgggtgcccgacgggcagtggtacctgcacctgttc
gcgccccagcagcccgacctgaactgggagaacgagcaggtccgcgccgacttccgcacc
acgctgaagttctggtgcgaccggggcgtcgacggcttccgggtcgacgtcgcgcacgcg
ctggtcaaggacctgaccgagccgctgcgcgacctcggcgcccccgagctgagcggcgag
gcggccctcgcgcagttcgcgcccggcacccaccccttctacgaccgcgacgacgtccac
gaggtctaccgcgactggcgcaagatcctcgacgcctacaccccgccccgcacggccgtc
gccgaggcctgggtcccgggcccccggcgcgtgctgtacgcccgcccggacgaactcggc
caggccttcaacttcgagtacctccagaccggctgggacgccgccgagctgcgcgaggtc
atcaccggctcactggccgacgcgcgggccgccggtgcctcggcgacctgggtgctgtcc
aaccacgacgtcgtccggcacgccacccgcctggtcctgccgccggacaccgacaccgac
gcctggctgctgtccggcggccgggcgcccgccgtcgacccggcggccgggctgcgccgg
gcccgcgcggcgacgctgctgatgctggcgctgcccggctcggcgtacctctaccagggc
gaggagctgggtctgcccgaggtggccggcctgcccaccgaggtactccaggacccgatc
tgggagcagaccggccacgtccgcaagggccgcgacggctgccgggtgccgctgccctgg
acgacggaggggccctcgtacggcttcggcgcgggcggggcgtggctgccgcagccgccg
gacttcgcggcgtacgccgtccaggcccaggacggggtggcgggctcgacgctggagctg
taccgcacggcgctgcgcctgcgccgcaagctgctcgccggcgagtcgctgacctggtcg
gacgacgtaccggcgggagtgctgcggttcgaccgctcggacggctggcgctgcgtcacc
aacctctccggcacggcggtggacctgccggccggcgaggtgctgctcagcagcgcgccc
ctggaggacggccggctgggcccggacacgacggtgtggctgggcctgtaa

DBGET integrated database retrieval system