KEGG   Streptomyces coelicolor: SCO3817Help
Entry
SCO3817           CDS       T00085                                 

Gene name
bkdA1, SCGD3.18c
Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E1 subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00020  Citrate cycle (TCA cycle)
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO3817 (bkdA1)
   00020 Citrate cycle (TCA cycle)
    SCO3817 (bkdA1)
   00620 Pyruvate metabolism
    SCO3817 (bkdA1)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SCO3817 (bkdA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 1099253
NCBI-ProteinID: NP_628006
Kitasato: SCO3817
UniProt: Q9XA60
Position
complement(4195943..4197196)
Genome map
AA seq 417 aa AA seqDB search
MTESTAARKPRRSAGSKAAGTTGTKAAGTTGSKAGTGKRTTRTTSTTRTAAEKGSDTELV
QLLTPEGERVEDAAHAEYASYVADITPDELRGLYRDMVLTRRFDAEATALQRQGELGLWA
SLLGQEAAQIGSGRATREDDYVFPTYREHGVAWCRGVDPTNLLGMFRGVNNGGWDPNSNN
FHLYTIVIGSQALHATGYAMGVAKDGADSGVIAYFGDGASSQGDVSEAFNFAAVYNAPVV
FFCQNNQWAISESNEKQTRVPLYQRAQGFGFPGVRVDGNDVLASLAVTRWALDRARRGEG
PALIEAYTYRMGAHTTSDDPSRYRHDDERAAWEAKDPILRLRRFLESANHADEGFFAELE
AESETLGKRVREVVRAMPDPDRFAIFENVYADGHALVDEERAQFAAYQASFADAEGV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagagcactgccgcgcgcaagccgcgacgcagcgccggaagcaaggcggccggc
accaccggcaccaaggcggccgggaccaccggcagcaaggccggcaccggcaagcgcacg
actcgcaccaccagcaccacccgtaccgctgccgagaagggctccgacacggagctggtg
cagctgctgacgcccgagggcgagcgcgtcgaggacgccgcccacgccgaatacgcctcg
tacgtcgccgacatcacccccgacgagctgcgcggcctgtaccgcgacatggtgctcacc
cggcgcttcgacgccgaggccaccgccctgcagcgccagggcgagctgggcctgtgggcc
tccctgctcggccaggaggccgcccagatcggctccggccgggccacccgcgaggacgac
tacgtcttcccgacctaccgcgagcacggcgtcgcctggtgccgcggcgtcgacccgacc
aacctcctcggcatgttccgcggggtgaacaacggcggctgggaccccaacagcaacaac
ttccacctgtacaccatcgtcatcggctcgcaggcgctgcacgccacgggctacgcgatg
ggcgtggccaaggacggcgccgactcgggcgtgatcgcgtacttcggcgacggcgcctcc
agccagggcgacgtcagcgaggcgttcaacttcgccgccgtctacaacgcgcccgtggtg
ttcttctgccagaacaaccagtgggcgatctccgagtccaacgagaagcagacccgggtg
ccgctctaccagcgcgcccagggcttcggcttccccggagtccgcgtcgacggcaacgac
gtgctggcctccctcgcggtcacccgctgggccctggaccgcgcccggcgcggcgaggga
ccggcgctgatcgaggcgtacacgtaccgcatgggcgcgcacaccacctcggacgacccc
tcccgctaccggcacgacgacgagcgcgccgcctgggaggcgaaggacccgatcctgcgc
cttcgccgcttcctggagtccgcaaaccacgcggacgagggattcttcgcggaactggag
gccgagagcgagacgttgggcaagcgagtgcgcgaagtggtccgtgccatgccggacccg
gaccggttcgccatcttcgagaacgtgtacgcggacgggcacgcgctcgtggacgaggag
cgggcgcagttcgccgcgtaccaggcatcgttcgcagacgcagagggggtctga

DBGET integrated database retrieval system