KEGG   Streptomyces coelicolor: SCO3851Help
Entry
SCO3851           CDS       T00085                                 

Gene name
SCH69.21c
Definition
(RefSeq) para-aminobenzoate synthase component II
  KO
K01664  
para-aminobenzoate synthetase component II [EC:2.6.1.85]
Organism
sco  Streptomyces coelicolor
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCO3851 (SCH69.21c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     SCO3851 (SCH69.21c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4237521..4238159)
Genome map
AA seq 212 aa AA seqDB search
MSARILVVDNYDSFVFNLVQYLYQLGAECEVLRNDEVSTAHAQDGFDGVLLSPGPGTPEQ
AGVCVDMVRHCAATGVPVFGVCLGMQSMQVAYGGVVDRAPELLHGKTSPVEHTGRGVFAG
LPSPFTATRYHSLAAEPATVPAELEVTARTPDGIVMGLRHRELLVEGVQFHPESVLTEHG
HRMLANWLVECGDQDAVARSAGLAPVVGRATA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcgcatcctcgtcgtcgacaactacgacagcttcgtcttcaacctggtccag
tacctctaccaactcggcgccgagtgcgaggtgctgcgcaacgacgaggtgtcgacggcc
cacgcccaggacggtttcgacggcgtcctgctctcgcccggcccgggcacgccggagcag
gcgggcgtctgcgtcgacatggtccggcactgcgcggcgaccggggtgccggtcttcggc
gtgtgcctgggcatgcagtcgatgcaggtcgcgtacggcggtgtggtggaccgcgcgccg
gagctgctgcacggcaagacctcgccggtggagcacaccggccggggcgtcttcgcgggg
ctgccctcgccgttcacggcgacgcggtaccactcgctggcggcggagccggccacggtg
ccggccgagctggaggtgacggcccgtacgccggacgggatcgtgatgggcctgcgccac
cgggaactgctcgtcgagggcgtgcagttccacccggagtcggtgctgaccgagcacggg
caccggatgctggccaactggctggtggagtgcggcgaccaggacgcggtggcgaggtcg
gcggggctcgccccggtggtgggcagggccacggcgtga

DBGET integrated database retrieval system