KEGG   Streptomyces coelicolor: SCO3890Help
Entry
SCO3890           CDS       T00085                                 

Gene name
SCH24.12c, trxB
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO3890 (SCH24.12c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     SCO3890 (SCH24.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(4280583..4281551)
Genome map
AA seq 322 aa AA seqDB search
MSDVRNVIIIGSGPAGYTAALYTARASLKPLVFEGAVTAGGALMNTTEVENFPGFQDGIM
GPELMDNMRAQAERFGAELIPDDVVAVDLSGEIKTVTDTAGTVHRAKAVIVTTGSQHRKL
GLPNEDALSGRGVSWCATCDGFFFKDQDIAVIGGGDTAMEEATFLSRFAKSVTIVHRRDT
LRASKAMQERAFADPKISFVWDSEVAEVQGDQKLAGLKLRNVKTGELSDLPVTGLFIAIG
HDPRTELFKGQLDLDPEGYLKVDAPSTRTNLTGVFGAGDVVDHTYRQAITAAGTGCSAAL
DAERFLAALSDEDKAEPEKTAV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgtccgaaacgtgatcatcatcggctccgggcccgccggctacacggcggcg
ctctacaccgcgcgagcatccctgaagccgctggtgttcgagggtgccgtcaccgcgggc
ggagcgctgatgaacaccaccgaggtggagaacttccccggcttccaggacggcatcatg
ggccccgagctcatggacaacatgcgggcccaggcggagcgcttcggcgccgagctgatc
ccggacgacgtcgtggccgtcgacctcagcggcgagatcaagaccgtcaccgacaccgcg
ggcacggtccaccgggccaaggccgtgatcgtcaccaccggctcccagcaccgcaagctc
ggcctgccgaacgaggacgcgctgtccggtcgcggtgtctcctggtgcgcgacctgtgac
ggcttcttcttcaaggaccaggacatcgccgtgatcggcggcggggacaccgcgatggag
gaggccaccttcctctcccgcttcgcgaagtccgtgacgatcgtccaccgccgggacacc
ctgcgcgcctccaaggcgatgcaggagcgtgccttcgccgaccccaagatctcgttcgtc
tgggacagcgaggtcgccgaggtccagggcgaccagaagcttgcgggcctgaagctgcgc
aacgtcaagaccggcgagctctccgatctgccggtgaccggcctgttcatcgcgatcggc
cacgacccgcgcaccgagctcttcaagggccagctcgacctggacccggagggctacctg
aaggtcgacgcgccctcgacgcgcaccaacctgacgggtgtcttcggggccggtgacgtg
gtcgaccacacctaccgacaggcgatcaccgctgcgggcaccggctgctccgccgcgctc
gacgccgagcgcttcctcgccgccctcagcgacgaggacaaggcggagcccgagaagacc
gccgtctga

DBGET integrated database retrieval system