KEGG   Streptomyces coelicolor: SCO3920Help
Entry
SCO3920           CDS       T00085                                 

Gene name
cysA, SCQ11.03c
Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  
cystathionine gamma-lyase [EC:4.4.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3920 (cysA)
   00270 Cysteine and methionine metabolism
    SCO3920 (cysA)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO3920 (cysA)
Enzymes [BR:sco01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     SCO3920 (cysA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO3920 (cysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(4315547..4316725)
Genome map
AA seq 392 aa AA seqDB search
MSDSATTDSAGTGGERSASAPGDGTRAVRAGLPEPVKHEPTLPGPVFAAHFHLPGDPTGP
YTYGRDENPTWTRLESAIGELEAPGEAGVETLVFASGMAAISSVLFSQLRAGDTAVLPDD
GYQALPLVRAQLEAYGIEVRTAPTGRDAQLDVLDGAKLLWIETPSNPGLDVCDVRRLVEA
AHAGGALVAVDNTLATPLGQRPLELGADFSVASGTKQLTGHGDVLLGYVAGRDAGAMAAV
RRWRKIVGAIPGPMEAWLAHRSIATLQLRVDRQDSTALKVAEALRTRPEITGLRYPGLPD
DPSHKVASQQMLRYGCVVSFTLPSRARADRFLDALRLVEGATSFGGVRSTAERRGRWGGD
AVPEGFIRLSVGAEDPDDLVADLLRALDETTE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccgctaccaccgacagcgccggtacgggcggggagagatccgcttccgct
cccggtgacggcacgcgcgcggtgcgggccgggctgcccgaaccggtcaagcacgaaccc
accctgccgggcccggtgttcgccgcccacttccacctgccgggggatccgaccgggccg
tacacctacggccgcgacgagaacccgacctggacccgcctcgagagcgccatcggcgag
ctggaggcgcccggagaggccggcgtggagacactcgtcttcgcctcgggcatggccgcg
atctcctcggtgctcttctcgcagctgcgcgccggcgacacggccgtcctgcccgacgac
ggctatcaggcgctgccactggtccgggctcagctggaggcgtacggcatcgaggtgcgc
accgcgccgaccggccgggacgcgcagctcgacgtcctggacggggcgaagctgctgtgg
atcgagacgccgtcgaacccggggctcgacgtgtgcgacgtacggcggctcgtcgaggcg
gcgcacgcgggcggtgccctggtggccgtcgacaacaccctcgccaccccgctcgggcag
cgcccgctggagctcggcgcggacttctcggtggccagcggaaccaagcagctcaccggc
cacggagacgtcctgctgggctacgtggccggccgcgacgccggggcgatggccgccgtt
cggcgctggcgcaagatcgtcggtgcgattcccggccccatggaggcctggctcgcgcac
cgctcgatcgccaccctccagctgcgcgtggaccggcaggactccaccgcgctcaaggtg
gccgaagccctccgcacccggcccgagatcaccggcctgcggtaccccgggctgccggac
gacccgtcccacaaggtcgcctcgcagcagatgctgcgctacggctgtgtcgtctccttc
acgctgccctcgcgcgcgcgtgccgatcgttttctcgacgcgctgcgcctcgtcgagggc
gcgacgagcttcggcggggtgcggtccacggcggagcggcgcgggcgctggggcggcgac
gcggtgccggagggcttcatccggctctccgtcggcgcggaggaccccgacgacctggtg
gccgatctgctgcgcgcgctggacgaaacgacggaatga

DBGET integrated database retrieval system