KEGG   Streptomyces coelicolor: SCO3920Help
Entry
SCO3920           CDS       T00085                                 

Gene name
cysA, SCQ11.03c
Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  
cystathionine gamma-lyase [EC:4.4.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO3920 (cysA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3920 (cysA)
   00270 Cysteine and methionine metabolism
    SCO3920 (cysA)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO3920 (cysA)
Enzymes [BR:sco01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     SCO3920 (cysA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO3920 (cysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(4315547..4316725)
Genome map
AA seq 392 aa AA seqDB search
MSDSATTDSAGTGGERSASAPGDGTRAVRAGLPEPVKHEPTLPGPVFAAHFHLPGDPTGP
YTYGRDENPTWTRLESAIGELEAPGEAGVETLVFASGMAAISSVLFSQLRAGDTAVLPDD
GYQALPLVRAQLEAYGIEVRTAPTGRDAQLDVLDGAKLLWIETPSNPGLDVCDVRRLVEA
AHAGGALVAVDNTLATPLGQRPLELGADFSVASGTKQLTGHGDVLLGYVAGRDAGAMAAV
RRWRKIVGAIPGPMEAWLAHRSIATLQLRVDRQDSTALKVAEALRTRPEITGLRYPGLPD
DPSHKVASQQMLRYGCVVSFTLPSRARADRFLDALRLVEGATSFGGVRSTAERRGRWGGD
AVPEGFIRLSVGAEDPDDLVADLLRALDETTE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccgctaccaccgacagcgccggtacgggcggggagagatccgcttccgct
cccggtgacggcacgcgcgcggtgcgggccgggctgcccgaaccggtcaagcacgaaccc
accctgccgggcccggtgttcgccgcccacttccacctgccgggggatccgaccgggccg
tacacctacggccgcgacgagaacccgacctggacccgcctcgagagcgccatcggcgag
ctggaggcgcccggagaggccggcgtggagacactcgtcttcgcctcgggcatggccgcg
atctcctcggtgctcttctcgcagctgcgcgccggcgacacggccgtcctgcccgacgac
ggctatcaggcgctgccactggtccgggctcagctggaggcgtacggcatcgaggtgcgc
accgcgccgaccggccgggacgcgcagctcgacgtcctggacggggcgaagctgctgtgg
atcgagacgccgtcgaacccggggctcgacgtgtgcgacgtacggcggctcgtcgaggcg
gcgcacgcgggcggtgccctggtggccgtcgacaacaccctcgccaccccgctcgggcag
cgcccgctggagctcggcgcggacttctcggtggccagcggaaccaagcagctcaccggc
cacggagacgtcctgctgggctacgtggccggccgcgacgccggggcgatggccgccgtt
cggcgctggcgcaagatcgtcggtgcgattcccggccccatggaggcctggctcgcgcac
cgctcgatcgccaccctccagctgcgcgtggaccggcaggactccaccgcgctcaaggtg
gccgaagccctccgcacccggcccgagatcaccggcctgcggtaccccgggctgccggac
gacccgtcccacaaggtcgcctcgcagcagatgctgcgctacggctgtgtcgtctccttc
acgctgccctcgcgcgcgcgtgccgatcgttttctcgacgcgctgcgcctcgtcgagggc
gcgacgagcttcggcggggtgcggtccacggcggagcggcgcgggcgctggggcggcgac
gcggtgccggagggcttcatccggctctccgtcggcgcggaggaccccgacgacctggtg
gccgatctgctgcgcgcgctggacgaaacgacggaatga

DBGET integrated database retrieval system