KEGG   Streptomyces coelicolor: SCO3944Help
Entry
SCO3944           CDS       T00085                                 

Gene name
hisC2, SCD78.11
Definition
(RefSeq) aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco00350  Tyrosine metabolism
sco00360  Phenylalanine metabolism
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco00401  Novobiocin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SCO3944 (hisC2)
   00350 Tyrosine metabolism
    SCO3944 (hisC2)
   00360 Phenylalanine metabolism
    SCO3944 (hisC2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3944 (hisC2)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SCO3944 (hisC2)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SCO3944 (hisC2)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class II
   SCO3944 (hisC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 1099380
NCBI-ProteinID: NP_628128
Kitasato: SCO3944
UniProt: Q9ZBY8
Position
4339565..4340644
Genome map
AA seq 359 aa AA seqDB search
MSETSPKLRAELEGIPTYKPGKPAAADGPVAYKLSSNENPYPPLPGVMETVTAAAASFNR
YPDMACTSLMAELSDRFGVPLAHLATGTGSVGVAQQLIQATSGPGDEVIYAWRSFEAYPI
ITQISGARSVQVPLTPGEVHDLDAMADAITDRTRLIFVCNPNNPTGTVVRRAELERFLDR
VPSDVLVVLDEAYREFIRDAEVPDGVEFYRERPNVCVLRTFSKAYGLAGLRVGFAIAHEP
VAAALRKTAVPFGVSQIAQEAAIASLRAEDELIGRVGSLVCERARVADALRAQGWTVPES
QANFVWLRLGERTLAFANACEQAGVVVRPFAGEGVRVTVGESEANDIFLKVSEEFRKEL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagacgagccccaagctgcgcgccgagctggaggggattcccacctacaagccg
ggcaagcccgccgcggccgacggtccggtggcctacaagctgtcctccaacgagaacccc
tacccgccactgccgggagtgatggagacggtgacggccgccgccgcctccttcaaccgc
tacccggacatggcctgcacgtcgctgatggccgagctgtccgaccgcttcggcgtgccc
ctggcccacctggccaccggcaccggctcggtcggtgtggcccagcagctgatccaggcg
acctcgggccccggcgacgaggtgatctacgcctggcgctccttcgaggcgtacccgatc
atcacgcagatcagcggcgcgaggtccgtgcaggtaccgctgacgccgggcgaggtgcac
gacctggacgccatggcggacgcgatcaccgaccgcacccggctgatcttcgtctgcaac
cccaacaaccccacgggcacggtagtacggcgggccgagctggagcggttcctggaccgg
gtgccgagcgacgtgctggtggtcctggacgaggcctaccgcgagttcatccgggacgcc
gaggtcccggacggcgtcgagttctaccgtgagcggcccaacgtgtgcgtcctgcgcacc
ttctccaaggcctacggcctggcggggctgcgggtcgggttcgcgatcgcccacgagccg
gtggcggcggcgctgcgcaagacggcggtgcccttcggggtcagccagatcgcgcaggag
gcggcgatcgcctcgctgcgcgcggaggacgagctgatcggccgggtcggttcgctggtg
tgcgagcgcgcccgcgtggccgacgcgctgcgcgcgcagggctggacggtgccggagagc
caggccaacttcgtctggctgcgactgggagaacgcacgctcgcctttgcgaacgcctgc
gagcaggccggcgtggtcgtccgccccttcgcgggcgagggcgtgcgcgtgacggtcggg
gagagcgaggcgaacgacatcttcctgaaggtgtcggaggagttccgcaaggagctgtag

DBGET integrated database retrieval system