KEGG   Streptomyces coelicolor: SCO3945Help
Entry
SCO3945           CDS       T00085                                 

Gene name
cydA, SCD78.12
Definition
(RefSeq) cytochrome oxidase subunit I
  KO
K00425  
cytochrome d ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
sco  Streptomyces coelicolor
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome d ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SCO3945 (cydA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO3945 (cydA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     SCO3945 (cydA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
4340932..4342437
Genome map
AA seq 501 aa AA seqDB search
MDLALAPETLARWQFGITTVYHFLFVPLTISLAALTAGLQTAWVRTEKEKYLRATKFWGK
LFLINIAMGVVTGIVQEFQFGMNWSDYSRFVGDVFGAPLAFEALIAFFFESTFIGLWIFG
WDKLPKKIHLACIWMVSIGTLLSAYFILAANSWMQHPVGYRINEEKGRAELTDFWQVLTQ
NTTLNQVFHSFSAAFLTGGAFMVGIAAFHLMRKKHIPVMRTSLRLGLVTLAVGGLLTAVS
GDTLGKVMYEQQPMKMAAAEALWDGEKPAPFSVFAYGDVDKGHNKVALEVPGLLSFLAHS
DFESYVPGINDTNKALQEQFGPGDYKPIVPVAYWGFRWMIGFGMASFSLGLLGLWLTRKR
FLLPPALRTGEDEVPHLVLLKKPLGARLTRMYWLLALWTMAFPLIANSWGWIFTEMGRQP
WVVYGVMQTRDAVSPGVSTAEVIISMSVFTLLYAVLAVIEVKLLAKYVKAGPPELTEADL
NPPTKIGGDLRDADKPMAFSY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggacctggctctggcgccggagacgctggcgcgatggcagttcggcatcacgaccgtc
taccacttcctgttcgtcccgctgacgatctcgctggccgccctcacggccggactgcag
accgcctgggtccgcacggagaaggagaagtacctcagggcgaccaagttctggggcaag
ctcttcctgatcaacatcgcgatgggtgtcgtcaccggcatcgtgcaggagttccagttc
ggcatgaactggtccgactactcccgcttcgtcggcgacgtcttcggcgccccgctcgcc
ttcgaggcgctgatcgccttcttcttcgagtccaccttcatcggcctgtggatcttcggc
tgggacaagctgcccaagaagatccacctggcctgcatctggatggtctcgatcggcacg
ctgctgtcggcgtacttcatcctcgcggccaactcctggatgcagcaccccgtgggctac
cggatcaacgaggagaagggccgcgccgaactcaccgacttctggcaggtcctcacccag
aacaccaccctcaaccaggtcttccacagcttctcggcggccttcctcacgggcggcgcc
ttcatggtcggcatcgccgccttccacctgatgcgcaagaagcacatcccggtgatgcgg
acctcgctccggctcggcctggtgaccctggcggtcggcggcctgctcaccgcggtcagc
ggcgacaccctcggcaaggtcatgtacgagcagcagccgatgaagatggccgccgccgag
gccctgtgggacggcgagaagccggcacccttctcggtcttcgcctacggggacgtggac
aaggggcacaacaaggtcgccctggaggtccccgggctgctgtccttcctcgcgcacagc
gacttcgagtcctacgtgcccggcatcaacgacaccaacaaggccctccaggagcagttc
gggcccggtgactacaagcccatcgtccccgtcgcctactggggcttccggtggatgatc
ggcttcggcatggcgtccttctccctcggcctgctgggcctgtggctgacgcggaagcgg
ttcctgctgccaccggccctgcgcaccggggaggacgaggtcccgcacctggtgctgttg
aagaagccgctcggggcgaggctcacccggatgtactggctgctggcgctgtggacgatg
gcgttccccctgatcgccaactcctggggctggatcttcacggagatgggccggcagccc
tgggtggtctacggcgtgatgcagacccgggacgcggtctcccccggcgtctccacggcc
gaggtcatcatctcgatgtccgtcttcaccctgctgtacgccgtcctggccgtcatcgag
gtcaagctcctggcgaagtacgtgaaggccggaccgcccgagctgaccgaggccgacctc
aatccgcccacgaagatcggcggcgatctccgtgacgccgacaagccgatggccttctcg
tactag

DBGET integrated database retrieval system