KEGG   Streptomyces coelicolor: SCO3962Help
Entry
SCO3962           CDS       T00085                                 

Gene name
pheA, SCD78.29c
Definition
(RefSeq) prephenate dehydratase
  KO
K04518  
prephenate dehydratase [EC:4.2.1.51]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO3962 (pheA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO3962 (pheA)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     SCO3962 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(4362335..4363267)
Genome map
AA seq 310 aa AA seqDB search
MPASYAYLGPEGTFTEVALRTLPETATRELVPYVSVQSALDAVRTGEAEAAFVPIENSVE
GGITTTLDELVAGQPLMIYREVLLSITFALLVRPGTKLSDIKTVTAHPAAQPQVRNWIKA
HLPDVAWESAASNADGARLVQEGRYDAAFAGEFAAERYGLEVLEADIHDAENAQTRFVLV
GRPARPAAPTGADKTSVVLWQRDDHPGGLRDLLGEFATRGINLMLLQSRPTGAGIGNYCF
CIDAEGHISDRRVADALMGLKRTCLQVRYLGSYPRAEVTPADVDALRPGTSDEAFVAAAD
WVARCQDGRF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccagccagttacgcgtatctcggccctgaaggcaccttcaccgaagtcgccctgcgc
actctcccggagacggcgacccgggaactggtcccgtacgtctccgtgcagtccgcgctc
gacgcggtgcgcaccggcgaggccgaggccgcgttcgtgccgatcgagaactccgtcgag
ggcggcatcaccaccaccctcgacgagctggtcgccggccagccgctgatgatctaccgc
gaggtgctgctgtccatcaccttcgcgctgctggtccggcccggcaccaagctgtcggac
atcaagacggtcaccgcccacccggcggcgcagccccaggtccgcaactggatcaaggcg
cacctcccggacgtcgcctgggagtcggccgcctccaacgcggacggtgcccggctggtg
caggaggggcggtacgacgccgccttcgccggtgagttcgccgcggagcgctacggcctc
gaggtgctggaggccgacatccacgacgcggagaacgcccagacgcgcttcgtgctggtg
ggccgcccggcccggcccgcggcaccgaccggggcggacaagacgtccgtcgtactctgg
cagcgcgacgaccaccccggcggcctgcgcgatctgctgggcgagttcgccacccggggc
atcaacctgatgctgctgcaatcccggcccaccggtgcgggcatcggcaactactgcttc
tgcatcgacgccgaggggcacatctccgaccgacgggtggccgacgcgttgatgggcctg
aagcggacctgtctccaggtgcgctatctggggtcgtatccgcgtgcggaggtcacgccc
gccgatgtggacgcactgcgtccgggcacctcggacgaggcgttcgtggcagcggcggac
tgggtggcacgctgccaggacggccggttctga

DBGET integrated database retrieval system