KEGG   Streptomyces coelicolor: SCO4068Help
Entry
SCO4068           CDS       T00085                                 

Gene name
purD, SCD25.04
Definition
(RefSeq) phosphoribosylamine--glycine ligase
  KO
K01945  
phosphoribosylamine--glycine ligase [EC:6.3.4.13]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4068 (purD)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     SCO4068 (purD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
4459642..4460892
Genome map
AA seq 416 aa AA seqDB search
MKVLVIGGGAREHALCRSLSLDPDVTALHCAPGNAGIAEVAELHQVDALDGAAVTALAGR
LGAELVVVGPEAPLVAGVADAVREAGIPVFGPSGEAARLEGSKAFAKDVMACAGVPTARS
YVCTNPAEVDAALAAFGAPYVVKDDGLAAGKGVVVTDDVEAARAHANACDRVVVEEFLDG
PEVSLFAVTDGENVRPLQPAQDFKRALDGDEGPNTGGMGAYSPLPWADPKLVDEVVQSVL
QPTVDEMRRRGTPFSGLLYAGLAITSRGVRVIEFNARFGDPETQVVLARLKTPLAGLLMA
AATGNLADLEPLRWSDEAAVTVVVASHNYPGTPRTGDPITGLDEVAAQDAPHAYVLHAGT
RAEGDAVVSAGGRVLSVTATGADLTEARDRAYRAVARIGLDGSQHRTDIAAKAAGA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtccttgtcatcggcggcggcgcccgcgaacacgccctgtgccgttccctgtcc
ctcgaccccgacgtcaccgcgctgcactgcgcacccggcaacgccggtatcgccgaggtc
gccgaactgcaccaggtcgacgccctcgacggcgcggccgtcaccgcgctggccggccgg
ctcggcgccgagctggtcgtcgtcggacccgaggcgcccctggtcgccggggtcgccgac
gccgtccgcgaggcgggcatcccggtcttcggtccctcgggggaggcggcccggctggag
ggctccaaggccttcgccaaggacgtgatggcctgcgcgggcgtgcccacggcccgctcc
tacgtctgcaccaaccccgccgaggtcgacgcggccctcgccgccttcggcgcgccctac
gtcgtcaaggacgacgggctggccgcgggcaagggcgtcgtcgtcaccgacgacgtcgag
gcggcccgcgcgcacgcgaacgcctgcgaccgcgtcgtcgtcgaggagttcctggacggc
cccgaggtctccctgttcgccgtcaccgacggcgagaacgtccgcccgctccagcccgcc
caggacttcaagcgcgccctcgacggcgacgagggcccgaacaccggcggcatgggcgcc
tactccccgctgccctgggccgacccgaagctggtcgacgaggtcgtacagagcgtgctc
cagccgacggtcgacgagatgcgccgccgcggcaccccgttctccggacttctgtacgcc
gggctcgcgatcacctcgcgcggtgtgcgcgtgatcgagttcaacgcccgtttcggcgac
cccgagacccaggtcgtgctggcccggctgaagaccccgctcgccggtctgctgatggcc
gccgccaccggcaacctcgccgacctcgagccgctgcgctggagcgacgaggcggccgtc
accgtggtcgtcgcctcgcacaactaccccggcaccccgcgcaccggcgacccgatcacc
ggcctcgacgaggtggccgcccaggacgccccgcacgcctacgtactgcacgccggcacc
cgcgccgagggcgacgccgtcgtcagcgccgggggccgcgtcctctccgtcacggccacc
ggcgccgacctgaccgaggcccgcgaccgggcctaccgggccgtcgcccgtatcggcctc
gacggctcgcagcaccgcaccgacatcgcggcgaaggcggcgggcgcgtag

DBGET integrated database retrieval system