KEGG   Streptomyces coelicolor: SCO4071Help
Entry
SCO4071           CDS       T00085                                 

Gene name
hemH
Definition
(RefSeq) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  
phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4071 (hemH)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     SCO4071 (hemH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
4464986..4465885
Genome map
AA seq 299 aa AA seqDB search
MSGFVEKPEPIQVPGLVHLHTGKVRELYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRV
LTQLSLWWFDQLADLAPNHVLSTELPPGAPADWEGRALVCKSLRMVPVECVARGYLTGSG
LAEYDETRTVCGLALPEGLVDGSELPAPIFTPATKAEVGEHDENVSYEEVARQVGADTAA
ALRQATLAVYSRARDIARERGIVLADTKFEFGFDGDDLVLADEVLTPDSSRFWPADRWQP
GRAQPSYDKQFVRDWLTSAESGWDRKSEQPPPPLPQQVVDATRAKYVEAYELLTGQSWS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggattcgttgaaaagcccgagccgatccaggttccgggtctggtgcatctgcac
accggcaaggtgcgcgagctgtaccggaacgaggcgggcgacctcgtgatggtcgccagc
gaccgcatctccgcctacgactgggtgctgccgaccgagatccccgacaagggccgggtc
ctcacccagctctccctgtggtggttcgaccagctcgccgacctggcccccaaccacgtc
ctgagcaccgagctgccccccggcgcccccgccgactgggagggccgcgccctggtctgc
aagtcgctgcggatggtccccgtggagtgcgtggcccgcggctacctcaccggctccggc
ctggcggagtacgacgagacccgcaccgtgtgcggcctcgccctgcccgagggactcgtc
gacggctcggagctgcccgccccgatcttcaccccggccaccaaggccgaggtcggcgag
cacgacgagaacgtctcctacgaggaggtcgcccgccaggtcggcgcggacaccgcggcc
gccctgcgccaggccaccctcgccgtctactcccgcgcccgggacatcgcccgcgagcgc
ggcatcgtcctcgcggacaccaagttcgagttcggcttcgacggggacgacctggtcctc
gccgacgaggtcctcaccccggactcctcccgcttctggccggccgaccggtggcagccg
ggccgcgcgcagccgtcgtacgacaagcagttcgtgcgggactggctgacctcggccgag
tccggctgggaccggaagagcgagcagcccccgccgccgctgccgcagcaggtcgtggac
gccacccgcgccaagtacgtggaggcctacgagctgctgaccggccagagctggtcgtag

DBGET integrated database retrieval system