KEGG   Streptomyces coelicolor: SCO4086Help
Entry
SCO4086           CDS       T00085                                 

Gene name
purF, SCD25.22
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  
amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4086 (purF)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4086 (purF)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     SCO4086 (purF)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO4086 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
4479261..4480853
Genome map
AA seq 530 aa AA seqDB search
MIHEWSRIPNSDQWSISPTLEGVPRGDGRLNHDLLPGEKGPQDACGVFGVWAPGEEVAKL
TYFGLYALQHRGQESAGIAVSNGSQILVFKDMGLVSQVFDETSLGSLQGHIAVGHARYST
TGASVWENAQPTFRATAQGSIALGHNGNLVNTAQLAGLVADLPKQDGRSTRVAATNDTDL
ITALLAGQVDDDGKPLTVEEAAGKVLPQVRGAFSLVFMDEHTLYAARDPQGIRPLVLGRL
ERGWVVASESAALDICGASYVREIEPGEFVAIDENGLRTSRFAEAKPKGCVFEYVYLARP
DTDIAGRNVYLSRVEMGRKLAKEAPAEADLVIATPESGTPAAIGYAEASGIPFGNGLVKN
AYVGRTFIQPSQTIRQLGIRLKLNPLKEVIKGKRLVVVDDSIVRGNTQRALVRMLREAGA
AEIHIRISSPPVKWPCFFGIDFATRAELIANGMSVEEIGTSMGADSLAYISIDGMIEATT
IAKPNLCRACFDGEYPMELPDPELLGKQLLETELAAGPAGTAAADAIRRP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgatccatgagtggtcccgtatccccaattcggaccagtggtcgatctcgcctacactc
gaaggcgtgccacgtggtgacggtcgactcaatcacgatctgcttcccggcgagaagggc
ccccaggacgcttgcggcgtcttcggtgtctgggctccgggcgaagaggtcgcaaagctc
acgtacttcgggctgtacgccctccagcatcggggccaggaatccgcgggaatcgcggtc
agcaacggctcccagatcctcgtcttcaaggacatgggcctggtgtcccaggtcttcgac
gagacctcgctcggttcgctccagggtcacatcgcggtcggtcacgcccgctactcgacc
accggtgcctccgtgtgggagaacgcccagccgacgttccgtgccaccgcgcagggttcc
atcgcgctcgggcacaacggcaacctcgtcaacaccgcccagctcgccgggctggtggcc
gacctgccgaagcaggacggccgctccacccgggtcgcggcgaccaacgacaccgacctg
atcaccgcgctgctcgcgggccaggtcgacgacgacggcaagccgctgaccgtcgaggag
gcggccggcaaggtgctgccccaggtgcgcggcgccttctccctcgtcttcatggacgag
cacaccctctacgccgcccgcgacccgcagggcatccgcccgctggtcctcggccgcctg
gagcgcggctgggtggtcgcctccgagtccgccgccctggacatctgcggcgcctcctac
gtccgggagatcgagccgggcgagttcgtcgccatcgacgagaacggcctgcggacatcg
cgattcgcagaagcgaagcccaagggctgtgtcttcgagtacgtgtacctggcccgcccg
gacaccgacatcgccggccgcaacgtctacctctcgcgtgtcgagatgggccgcaagctg
gcgaaggaggcccccgcggaggccgatctcgtcatagcgaccccggaatccggcaccccc
gccgcgatcggctacgccgaggcctccggcatccccttcggcaacggcctggtgaagaac
gcctatgtcggccggaccttcatccagccctcacagaccatccgccagctgggcatccgc
ctgaagctgaatcccctgaaggaagtcatcaagggcaagcggctggtcgtcgtcgacgac
tccatcgtccgcggcaacacccagcgggccctggtccgcatgctccgcgaggcgggcgcc
gccgagatccacatccggatctcgtccccgcccgtgaagtggccctgcttcttcggcatc
gacttcgccacccgcgccgagctgatcgccaacggcatgagcgtcgaggagatcggcacc
tcgatgggcgccgactccctggcgtacatctccatcgacggcatgatcgaggcgaccacc
atcgccaagcccaacctgtgccgcgcctgcttcgacggcgagtacccgatggagcttccc
gaccccgagctgctcggcaagcagctcctggagaccgagctggccgccgggcccgccggt
acggccgccgccgacgccatccgtcgcccgtag

DBGET integrated database retrieval system