KEGG   Streptomyces coelicolor: SCO4087Help
Entry
SCO4087           CDS       T00085                                 

Gene name
purM, SCD25.23
Definition
(RefSeq) phosphoribosylaminoimidazole synthetase
  KO
K01933  
phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4087 (purM)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     SCO4087 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
4480933..4482000
Genome map
AA seq 355 aa AA seqDB search
MPDTTGASYAAAGVDIEAGDRAVELMKEWVKKTRRPEVLGGLGGFAGLFDASALKNYERP
LLASATDGVGTKVDIARQLGVYDTIGHDLVAMVMDDIVVCGAEPLFMTDYICVGKVHPER
VAAIVKGIAEGCVLAGCALVGGETAEHPGLLGADDFDVAGAGTGVVEADRLLGPDRIRTG
DAVIAMASSGLHSNGYSLVRHVLLNEGGLALDAHLDGLGRTLGEELLEPTKIYSLDCLAL
MRTAEVHAFSHVTGGGLAANLARVIPDGLHAVVDRSTWTPGAIFDLVGRTGKVERLELEK
TLNMGVGMIAIVPEESTDVALTALADRGVDAWVAGEITDRADHESGAALVGDYAA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacacaactggtgccagctacgcagcagccggcgtcgacatcgaggcgggcgac
cgcgccgtcgagctcatgaaggaatgggtcaagaagacgcggcgccccgaggtcctcggc
ggcctcggcggcttcgccggcctcttcgacgcctccgccctcaagaactacgagcgcccg
ctgctcgcctccgccaccgacggcgtcggcaccaaggtcgacatcgcccgtcagctgggc
gtctacgacaccatcggtcacgacctggtcgcgatggtcatggacgacatcgtggtgtgc
ggcgccgagccgctgttcatgaccgactacatctgcgtcggcaaggtgcaccccgagcgc
gtcgccgcgatcgtcaagggcatcgccgagggctgtgtgctggcgggatgcgccctggtg
ggcggcgagacggccgagcaccccggcctgctgggcgcggacgacttcgacgtcgccggc
gccggtacgggcgtggtggaggccgaccgcctgctcggaccggatcgcatccgtacgggt
gacgcggtgatcgccatggcgtcctccgggcttcactcgaacgggtactcgctggtccgc
cacgtcctgctgaacgagggcggcctggcgctcgacgcccacctggacggtctcggccgc
accctcggcgaggagctgctggagccgaccaagatctactccctggactgcctggccctc
atgcgcaccgccgaggtccacgccttcagccacgtcaccggcggcggactcgcggccaac
ctggcccgcgtgatccccgacggcctgcacgccgtggtcgaccggtccacctggaccccg
ggggcgatcttcgacctcgtcggccggaccggcaaggtggagcgcctggagctggagaag
accctgaacatgggcgtgggcatgatcgcgatcgtgcccgaggagtcgacggacgtcgcc
ctgacggccctcgccgaccgcggtgtggacgcctgggtggccggcgagatcaccgaccgc
gcagaccacgagagcggcgcggcactggtgggcgactacgccgcctga

DBGET integrated database retrieval system