KEGG   Streptomyces coelicolor: SCO4138Help
Entry
SCO4138           CDS       T00085                                 

Gene name
pitH, SCD84.05
Definition
(RefSeq) phosphate transport protein
  KO
K03306  
inorganic phosphate transporter, PiT family
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
4552519..4553517
Genome map
AA seq 332 aa AA seqDB search
MDTFALVVTIGVALFFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFMGSG
VAKTVSEGVIETPEGSKGMGILFAALVGAIVWNLITWYFGLPSSSSHALFGGMVGAALAG
STTVYWHGVVDKIVIPMFVSPVIGLLAGYLVMTAIMWIFRRANPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGIVVMALVIADVEDYGDPIPVWVKLACALMLSLGTYAGGWRIMRT
LGRKIIELDPPQGFAAETTGASIMFGSAFIFHAPISTTHVITSAIMGVGATRRVNAVRWG
VAKNIIMGWFITMPAAAVVAAVSFWIVNLAVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacacctttgctctggtcgtgaccatcggggtcgcgctcttcttcacgtacaccaac
ggtttccacgattcggccaacgcgatcgccacctccgtgtcgacgcgcgcgctgacgccg
cgggcggcgctcgccatggccgcggtgatgaacctggccggcgcgttcatgggatccggg
gtcgccaagaccgtcagcgagggggtcatcgagacccccgagggttcgaaggggatgggg
atcctcttcgcggcgctcgtgggcgccatcgtctggaacctcatcacctggtacttcggg
ctgccctcgtcctcgtcgcacgcgctgttcggcggcatggtcggcgccgcgctggccggg
agtacgaccgtgtactggcacggggtcgtcgacaagatcgtcatccccatgttcgtgtcg
ccggtgatcggcctgctcgccggttacctggtgatgaccgcgatcatgtggatcttccgg
cgggccaacccgcacaaggcgaagcgcggcttccgcatcgcgcagaccgtgtcggcggcg
ggcatggcgctggggcacggcctgcaggacgcgcagaagacgatgggcatcgtggtgatg
gcactggtcatcgccgacgtcgaggactacggcgacccgatcccggtgtgggtgaagctc
gcctgtgcgctgatgctgtcgctcgggacgtacgcgggcggctggcggatcatgcggacg
ctggggcggaagatcatcgagctggacccgccccaggggttcgccgcggagacgacgggc
gcgtcgatcatgttcggttcggcgttcatcttccacgcgccgatctccacgacgcacgtg
atcacctcggcgatcatgggcgtgggggcgacgaggcgggtcaacgcggtgcggtggggg
gtcgcgaagaacatcatcatggggtggttcatcacgatgcccgccgccgcggtggtggcc
gcggtgtcgttctggatcgtgaacctggcggtcctgtag

DBGET integrated database retrieval system