KEGG   Streptomyces coelicolor: SCO4142Help
Entry
SCO4142           CDS       T00085                                 

Gene name
pstS, SCD84.09c
Definition
(RefSeq) phosphate-binding protein
  KO
K02040  
phosphate transport system substrate-binding protein
Organism
sco  Streptomyces coelicolor
Pathway
ABC transporters
Two-component system
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SCO4142 (pstS)
  Signal transduction
   02020 Two-component system
    SCO4142 (pstS)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    SCO4142 (pstS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(4556707..4557819)
Genome map
AA seq 370 aa AA seqDB search
MNRRALALGALAVSGALALTACGSDDTGGNSGSDSSSAAANSNIKCDDAKGQLQASGSSA
QKNAIDAWVKQYVAACNGVQINYNPTGSGAGITAFTQGQTAFAGSDSALKPDEIEASKKV
CKDGQAIDLPMVGGPIAVGFNVTGVDSLVLDAPTMAKIFDSKITNWNDEAIKKLNPDAKL
PDLKIQAFHRSDESGTTDNFTKYLKAAAPDDWKYEGGKSWEAKGGQSAQGSSGLAGQVKQ
TPGAISYFELSYAKDGIKTVDVKTAAAEPVKATVENATAAIGAAKVVGTGKDLALELDYT
PDAAGAYPLVLVTYEIACDKGNKADTLPATKSFLNYMASEDGQGLLADAGYAPMPTEIIT
KVRETISGLS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcgggccctcgctctcggtgctctcgccgtctccggcgccctggccctcacg
gcgtgcggctccgacgacaccggcggcaacagcggcagcgactccagctccgccgccgcc
aacagcaacatcaagtgcgacgacgccaagggccagctccaggcctccggctcgtccgcc
cagaagaacgccatcgacgcctgggtcaagcagtacgtcgccgcctgcaacggcgtgcag
atcaactacaacccgaccggttccggcgcgggcatcaccgccttcacgcagggccagacc
gcgttcgccggttcggactccgcgctgaagccggacgagatcgaggcctcgaagaaggtc
tgcaaggacggccaggccatcgacctgccgatggtcggcggcccgatcgcggtcggcttc
aacgtcaccggcgtcgactcgctcgtcctggacgcgccgaccatggcgaagatcttcgac
agcaagatcaccaactggaacgacgaggcgatcaagaagctcaaccccgacgccaagctg
cccgacctgaagatccaggccttccaccgctcggacgagtccggcaccacggacaacttc
accaagtacctgaaggccgccgcgcccgacgactggaagtacgagggcggcaagtcctgg
gaggccaagggcggccagtccgcgcagggctcctccggcctggccggccaggtgaagcag
acccccggcgccatctcgtacttcgagctgtcctacgccaaggacggcatcaagaccgtc
gacgtcaagaccgcagccgccgagccggtcaaggccaccgtcgagaacgccaccgccgcc
atcggcgcggccaaggtcgtcggcaccggcaaggacctggcgctggagctggactacacc
ccggacgccgccggcgcctacccgctggtcctggtgacgtacgagatcgcctgcgacaag
ggcaacaaggcggacaccctgcccgccaccaagtccttcctgaactacatggcctcggag
gacggccagggcctgctggcggacgccggctacgccccgatgcccaccgagatcatcacc
aaggtccgcgagaccatctcgggcctgagctga

DBGET integrated database retrieval system