KEGG   Streptomyces coelicolor: SCO4142Help
Entry
SCO4142           CDS       T00085                                 

Gene name
pstS, SCD84.09c
Definition
(RefSeq) phosphate-binding protein
  KO
K02040  phosphate transport system substrate-binding protein
Organism
sco  Streptomyces coelicolor
Pathway
sco02010  ABC transporters
sco02020  Two-component system
Module
sco_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SCO4142 (pstS)
  Signal transduction
   02020 Two-component system
    SCO4142 (pstS)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    SCO4142 (pstS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_11
Motif
Other DBs
NCBI-GeneID: 1099582
NCBI-ProteinID: NP_628319
Kitasato: SCO4142
UniProt: Q9KZV9
Position
complement(4556707..4557819)
Genome map
AA seq 370 aa AA seqDB search
MNRRALALGALAVSGALALTACGSDDTGGNSGSDSSSAAANSNIKCDDAKGQLQASGSSA
QKNAIDAWVKQYVAACNGVQINYNPTGSGAGITAFTQGQTAFAGSDSALKPDEIEASKKV
CKDGQAIDLPMVGGPIAVGFNVTGVDSLVLDAPTMAKIFDSKITNWNDEAIKKLNPDAKL
PDLKIQAFHRSDESGTTDNFTKYLKAAAPDDWKYEGGKSWEAKGGQSAQGSSGLAGQVKQ
TPGAISYFELSYAKDGIKTVDVKTAAAEPVKATVENATAAIGAAKVVGTGKDLALELDYT
PDAAGAYPLVLVTYEIACDKGNKADTLPATKSFLNYMASEDGQGLLADAGYAPMPTEIIT
KVRETISGLS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcgggccctcgctctcggtgctctcgccgtctccggcgccctggccctcacg
gcgtgcggctccgacgacaccggcggcaacagcggcagcgactccagctccgccgccgcc
aacagcaacatcaagtgcgacgacgccaagggccagctccaggcctccggctcgtccgcc
cagaagaacgccatcgacgcctgggtcaagcagtacgtcgccgcctgcaacggcgtgcag
atcaactacaacccgaccggttccggcgcgggcatcaccgccttcacgcagggccagacc
gcgttcgccggttcggactccgcgctgaagccggacgagatcgaggcctcgaagaaggtc
tgcaaggacggccaggccatcgacctgccgatggtcggcggcccgatcgcggtcggcttc
aacgtcaccggcgtcgactcgctcgtcctggacgcgccgaccatggcgaagatcttcgac
agcaagatcaccaactggaacgacgaggcgatcaagaagctcaaccccgacgccaagctg
cccgacctgaagatccaggccttccaccgctcggacgagtccggcaccacggacaacttc
accaagtacctgaaggccgccgcgcccgacgactggaagtacgagggcggcaagtcctgg
gaggccaagggcggccagtccgcgcagggctcctccggcctggccggccaggtgaagcag
acccccggcgccatctcgtacttcgagctgtcctacgccaaggacggcatcaagaccgtc
gacgtcaagaccgcagccgccgagccggtcaaggccaccgtcgagaacgccaccgccgcc
atcggcgcggccaaggtcgtcggcaccggcaaggacctggcgctggagctggactacacc
ccggacgccgccggcgcctacccgctggtcctggtgacgtacgagatcgcctgcgacaag
ggcaacaaggcggacaccctgcccgccaccaagtccttcctgaactacatggcctcggag
gacggccagggcctgctggcggacgccggctacgccccgatgcccaccgagatcatcacc
aaggtccgcgagaccatctcgggcctgagctga

DBGET integrated database retrieval system