KEGG   Streptomyces coelicolor: SCO4145Help
Entry
SCO4145           CDS       T00085                                 

Gene name
ppk, SCD84.12c
Definition
(RefSeq) polyphosphate kinase
  KO
K00937  
polyphosphate kinase [EC:2.7.4.1]
Organism
sco  Streptomyces coelicolor
Pathway
Oxidative phosphorylation
RNA degradation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SCO4145 (ppk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SCO4145 (ppk)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  polyphosphate kinase
     SCO4145 (ppk)
Messenger RNA biogenesis [BR:sco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     SCO4145 (ppk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4559965..4562289)
Genome map
AA seq 774 aa AA seqDB search
MKPTEPQPSGPFGPSDAPDARAARKNGFMRQPNTQAEAQHTQPSVGSIAAHRPNTVAATV
SGLEPDIDADLDAYEESEESQDGGARLPQGRFLDRERSWLAFNERVLELAEDPSTPLLER
ANFLAIFASNLDEFFMVRVAGLKRRIATGVATRSASGLQPREVLEMIWARSRELMARHAA
CFHEDVAPALAEEGIHLVRWSELAEKEQARLFTLFRHRIFPVLTPLAVDPAHPFPYISGL
SLNLAVVVRNPVTGHRHFARVKVPPLLSRFLEASPGRYVPVEDVIAAHLEELFPGMEVLE
HHTFRLTRNEDLEVEEDDAENLLQALEKELMRRRLGPPVRLEVEESVDREVLDLLVRELK
IGEAEVYPLPGPLDLTGLFRIHSIDRPELKYPKFVAGTHRDLAEVESASAPDIFAALRTK
DVLLHHPYDSFSTSVQAFLEQAAADPDVLAIKQTLYRTSGDSPIVDALIEAAESGKQVLV
LVEIKARFDESANIKWARKLEESGCHVVYGLVGLKTHCKLSLVVRQEGETLRRYSHVGTG
NYHPKTARLYEDLGLLTSDPQVGADLSDLFNRLSGYSRRETYRRLLVAPKSLRDGLVSRI
HKEIQHHRAGRPAHVRIKVNSMVDEAVVDACYRASQAGVPVDVWVRGICALRPGVPGLSE
NIRVRSVLGRFLEHSRVFAFGNGGEPEVWLGSADMMHRNLDRRIEALVRVTDPAHRAALN
RLLENGMSDGTASWHLGPDGEWTRHATDADGQPLRNIQEMLIDARRRRRGTATP
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaccgagccacagccttccgggcccttcgggccctccgacgcgcctgacgcg
cgcgcggcgcggaagaatgggttcatgaggcagccgaacactcaggccgaggcccagcac
acgcagccctccgtgggttccatcgcggcgcaccgcccgaacaccgtggccgccacggtc
tccggcctggagccggacatcgacgccgacctcgacgcgtacgaggagtcggaggagtcc
caggacggcggcgcccgcctcccgcagggccgcttcctggaccgcgaacgcagctggctc
gcgttcaacgaacgcgtgctcgaactcgccgaggacccgagcacccccctcctcgagcgt
gccaacttcctcgcgatcttcgccagcaacctggacgagttcttcatggtccgcgtcgcc
ggcctcaagcgccgcatcgcgaccggcgtcgccacccgctccgcctccggcctccagccc
cgcgaggtgctggagatgatctgggcccgctcccgcgagctgatggcccggcacgccgcc
tgcttccacgaggacgtcgccccggccctcgccgaggagggcatccacctggtccgctgg
agcgagctggccgagaaggagcaggcccgcctgttcaccctcttccggcaccggatcttc
ccggtcctcacccccctcgcggtcgaccccgctcaccccttcccgtacatctcgggcctc
tccctcaacctcgcggtcgtcgtccgcaaccccgtcaccggccaccgccacttcgcccgc
gtcaaggtccccccactgctctcccgcttcctggaggcctccccgggccgctacgtcccc
gtcgaggacgtcatcgccgcccacctggaggagctgttcccgggcatggaggtcctggag
caccacaccttccgcctcacccgcaacgaggacctggaggtcgaggaggacgacgcggag
aacctgctccaggccctggagaaggagctgatgcggcgccgcctgggcccgcccgtccga
ctggaggtcgaggagtccgtcgaccgcgaggtcctggacctcctcgtacgcgagctgaag
atcggcgaggcggaggtctacccgctccccggccccctggacctcaccggcctcttccgc
atccacagcatcgaccggcccgagctgaagtacccgaagttcgtcgccggcacccaccgc
gacctggccgaggtcgagtccgcgtccgcgccggacatcttcgccgccctgcgcaccaag
gacgtcctgctccaccacccgtacgactccttctccacctccgtgcaggcgttcctggag
caggccgccgccgacccggacgtcctcgcgatcaagcagacgctgtaccggacgtccggc
gactcccccatagtcgacgcgctcatcgaggcggccgagtccggcaagcaggtcctcgtc
ctggtggagatcaaggcccgcttcgacgagtccgccaacatcaagtgggcccgcaagctg
gaggagtccggctgccacgtcgtctacggcctggtgggcctgaagacccactgcaagctc
tccctggtcgtacggcaggagggcgagaccctgcgccggtacagccacgtcggcaccggc
aactaccacccgaagacggcccgcctctacgaggacctgggcctgctcacctcggacccg
caggtcggcgcggacctctccgacctgttcaaccgcctctccggctactcacggcgcgag
acctaccgccgcctcctcgtcgcgcccaagtcgctgcgcgacggcctcgtctcccgcatc
cacaaggagatccagcaccaccgcgccgggcgccccgcccacgtccgcatcaaggtcaac
tcgatggtcgacgaggccgtggtcgacgcctgctaccgcgcctcccaggccggtgtgccg
gtcgacgtgtgggtgcgcggcatctgcgcgctgcgcccgggcgtgccgggcctgtcggag
aacatccgggtccgctccgtcctcggccgcttcctggagcactcgcgggtcttcgccttc
ggcaacggcggtgagcccgaggtgtggctcggcagcgccgacatgatgcaccgcaacctc
gaccgccggatagaggccctggtccgggtgaccgacccggcccaccgggcggccctgaac
cggctcctcgagaacggcatgtccgacggcaccgcctcctggcacctcggcccggacggc
gagtggacccggcacgcgaccgacgcggacggccagcccctgcgcaacatccaggagatg
ctcatagacgcccggaggcgccggcgtggcacagcgacaccttga

DBGET integrated database retrieval system