KEGG   Streptomyces coelicolor: SCO4234Help
Entry
SCO4234           CDS       T00085                                 

Gene name
ispF
Definition
(RefSeq) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  KO
K01770  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
sco  Streptomyces coelicolor
Pathway
sco00900  Terpenoid backbone biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO4234 (ispF)
Enzymes [BR:sco01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     SCO4234 (ispF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YgbB
Motif
Other DBs
NCBI-GeneID: 1099674
NCBI-ProteinID: NP_628408
Kitasato: SCO4234
UniProt: Q9L0Q7
Position
4638344..4638856
Genome map
AA seq 170 aa AA seqDB search
MGSESSGTAELPPLPQVGIGTDIHAFEDGRELWCAGLKWEGEGTGLAGHSDADVVAHAAC
NALFSAAGAGDLGQHFGTGRPEWSGASGVTLLAEAARIVRARGFRIGNVAVQVVGARPKI
GKRRDEAEAVLSAAVGAPVSVSGATTDGLGFPGRGEGLMAVATALVVRGA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgagagttccggtacggcagagctgccgccgctgccgcaggtcgggatcggt
acggacatccacgccttcgaggacgggcgtgagctgtggtgcgccgggctgaagtgggag
ggcgaggggaccgggctcgccgggcactccgacgcggacgtcgtcgcgcacgcggcgtgc
aacgcgctgttctccgcggcgggggccggggacctggggcagcacttcggcaccgggcgg
ccggagtggtccggggcgtccggagtgacgctgctggcggaggcggcgcggatcgtacgg
gcgcgcgggttccggatcgggaacgtcgcggtgcaggtggtcggggcgcggccgaagatc
ggcaagcggcgggacgaggcggaggcggtgctctccgcggcggtgggggcgccggtgtcc
gtgtcgggggcgacgacggacgggctggggttcccggggcggggggaggggctgatggcg
gtggccacggcgttggtcgtgcggggggcttga

DBGET integrated database retrieval system